KEGG   Homo sapiens (human): 9641Help
Entry
9641              CDS       T01001                                 

Gene name
IKBKE, IKK-E, IKK-i, IKKE, IKKI
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit epsilon
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
Network
nt06121  TLR signaling (viruses and bacteria)
nt06133  RIG-I signaling (viruses)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06221  TLR signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00149  TLR3-IRF3 signaling pathway
N00268  HBV HBx to RIG-I-like receptor signaling pathway
N00271  HCV NS3/4A to RIG-I-like receptor signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00516  HCV NS3/4A to TLR3-IRF3 signaling pathway
N00552  HBV pol to TLR3-IRF3 signaling pathway
N00553  TLR4-IRF3/7 signaling pathway
N00554  HBV HBe to TLR4-IRF3/7 signaling pathway
N00555  HBV HBe to TLR4-IRF3/7 signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00685  MV V to RIG-I-IRF7/3 signaling pathway
N00727  IAV NS1 to RIG-I-like receptor signaling pathway
N00728  IAV NS1 to RIG-I-like receptor signaling pathway
N00732  IAV PB1-F2/PB2 to RIG-I-like receptor signaling pathway
N00734  IAV PB1-F2/PB2 to RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    9641 (IKBKE)
   04621 NOD-like receptor signaling pathway
    9641 (IKBKE)
   04622 RIG-I-like receptor signaling pathway
    9641 (IKBKE)
   04623 Cytosolic DNA-sensing pathway
    9641 (IKBKE)
   04625 C-type lectin receptor signaling pathway
    9641 (IKBKE)
   04657 IL-17 signaling pathway
    9641 (IKBKE)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    9641 (IKBKE)
   05164 Influenza A
    9641 (IKBKE)
   05161 Hepatitis B
    9641 (IKBKE)
   05160 Hepatitis C
    9641 (IKBKE)
   05168 Herpes simplex virus 1 infection
    9641 (IKBKE)
   05167 Kaposi sarcoma-associated herpesvirus infection
    9641 (IKBKE)
   05169 Epstein-Barr virus infection
    9641 (IKBKE)
   05165 Human papillomavirus infection
    9641 (IKBKE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9641 (IKBKE)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     9641 (IKBKE)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   9641 (IKBKE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD Pkinase_Tyr Pkinase_fungal Kinase-like RIO1
Motif
Other DBs
NCBI-GeneID: 9641
NCBI-ProteinID: NP_054721
OMIM: 605048
HGNC: 14552
Ensembl: ENSG00000263528
Vega: OTTHUMG00000184613
Pharos: Q14164(Tchem)
UniProt: Q14164
Position
1q32.1
AA seq 716 aa AA seqDB search
MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLR
KLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
KPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFA
ETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQEYLFEGHLCV
LEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLG
AGYQALRLARALLDGQELMFRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSV
AGTPEIQELKAAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSI
QQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKY
QASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKG
AQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAPPDV
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcacagccaattacctgtggcacacagatgacctgctggggcagggggccact
gccagtgtgtacaaggcccgcaacaagaaatccggagagctggttgctgtgaaggtcttc
aacactaccagctacctgcggccccgcgaggtgcaggtgagggagtttgaggtcctgcgg
aagctgaaccaccagaacattgtcaagctctttgcggtggaggagacgggcggaagccgg
cagaaggtactggtgatggagtactgctccagtgggagcctgctgagtgtgctggagagc
cctgagaatgcctttgggctgcctgaggatgagttcctggtggtgctgcgctgtgtggtg
gccggcatgaaccacctgcgggagaacggcattgtgcatcgcgacatcaagccggggaac
atcatgcgcctcgtaggggaggaggggcagagcatctacaagctgacagacttcggcgct
gcccgggagctggatgatgatgagaagttcgtctcggtctatgggactgaggagtacctg
catcccgacatgtatgagcgggcggtgcttcgaaagccccagcaaaaagcgttcggggtg
actgtggatctctggagcattggagtgaccttgtaccatgcagccactggcagcctgccc
ttcatcccctttggtgggccacggcggaacaaggagatcatgtaccggatcaccacggag
aagccggctggggccattgcaggtgcccagaggcgggagaacgggcccctggagtggagc
tacaccctccccatcacctgccagctgtcactggggctgcagagccagctggtgcccatc
ctggccaacatcctggaggtggagcaggccaagtgctggggcttcgaccagttctttgcg
gagaccagtgacatcctgcagcgagttgtcgtccatgtcttctccctgtcccaggcagtc
ctgcaccacatctatatccatgcccacaacacgatagccattttccaggaggccgtgcac
aagcagaccagtgtggccccccgacaccaggagtacctctttgagggtcacctctgtgtc
ctcgagcccagcgtctcagcacagcacatcgcccacacgacggcaagcagccccctgacc
ctcttcagcacagccatccctaaggggctggccttcagggaccctgctctggacgtcccc
aagttcgtccccaaagtggacctgcaggcggattacaacactgccaagggcgtgttgggc
gccggctaccaggccctgcggctggcacgggccctgctggatgggcaggagctaatgttt
cgggggctgcactgggtcatggaggtgctccaggccacatgcagacggactctggaagtg
gcaaggacatccctcctctacctcagcagcagcctgggaactgagaggttcagcagcgtg
gctggaacgcctgagatccaggaactgaaggcggctgcagaactgaggtccaggctgcgg
actctagcggaggtcctctccagatgctcccaaaatatcacggagacccaggagagcctg
agcagcctgaaccgggagctggtgaagagccgggatcaggtacatgaggacagaagcatc
cagcagattcagtgctgtttggacaagatgaacttcatctacaaacagttcaagaagtct
aggatgaggccagggcttggctacaacgaggagcagattcacaagctggataaggtgaat
ttcagtcatttagccaaaagactcctgcaggtgttccaggaggagtgcgtgcagaagtat
caagcgtccttagtcacacacggcaagaggatgagggtggtgcacgagaccaggaaccac
ctgcgcctggttggctgttctgtggctgcctgtaacacagaagcccagggggtccaggag
agtctcagcaagctcctggaagagctatctcaccagctccttcaggaccgagcaaagggg
gctcaggcctcgccgcctcccatagctccttaccccagccctacacgaaaggacctgctt
ctccacatgcaagagctctgcgaggggatgaagctgctggcatctgacctcctggacaac
aaccgcatcatcgaacggctaaatagagtcccagcacctcctgatgtctga

DBGET integrated database retrieval system