KEGG   Homo sapiens (human): 9648
Entry
9648              CDS       T01001                                 

Gene name
GCC2, GCC185, RANBP2L4, REN53
Definition
(RefSeq) GRIP and coiled-coil domain containing 2
  KO
K20282  GRIP and coiled-coil domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    9648 (GCC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9648 (GCC2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    9648 (GCC2)
SSDB
Motif
Pfam: Rab_bind GRIP Filament
Other DBs
NCBI-GeneID: 9648
NCBI-ProteinID: NP_852118
OMIM: 612711
HGNC: 23218
Ensembl: ENSG00000135968
Vega: OTTHUMG00000153214
Pharos: Q8IWJ2(Tbio)
UniProt: Q8IWJ2 B3KR21
Structure
PDB: 
3BBP

Position
2q12.3
AA seq 1684 aa
MEDLVQDGVASPATPGTGKSKLETLPKEDLIKFAKKQMMLIQKAKSRCTELEKEIEELRS
KPVTEGTGDIIKALTERLDALLLEKAETEQQCLSLKKENIKMKQEVEDSVTKMGDAHKEL
EQSHINYVKEIENLKNELMAVRSKYSEDKANLQKQLEEAMNTQLELSEQLKFQNNSEDNV
KKLQEEIEKIRPGFEEQILYLQKQLDATTDEKKETVTQLQNIIEANSQHYQKNINSLQEE
LLQLKAIHQEEVKELMCQIEASAKEHEAEINKLNELKENLVKQCEASEKNIQKKYECELE
NLRKATSNANQDNQICSILLQENTFVEQVVNEKVKHLEDTLKELESQHSILKDEVTYMNN
LKLKLEMDAQHIKDEFFHEREDLEFKINELLLAKEEQGCVIEKLKSELAGLNKQFCYTVE
QHNREVQSLKEQHQKEISELNETFLSDSEKEKLTLMFEIQGLKEQCENLQQEKQEAILNY
ESLREIMEILQTELGESAGKISQEFESMKQQQASDVHELQQKLRTAFTEKDALLETVNRL
QGENEKLLSQQELVPELENTIKNLQEKNGVYLLSLSQRDTMLKELEGKINSLTEEKDDFI
NKLKNSHEEMDNFHKKCEREERLILELGKKVEQTIQYNSELEQKVNELTGGLEETLKEKD
QNDQKLEKLMVQMKVLSEDKEVLSAEVKSLYEENNKLSSEKKQLSRDLEVFLSQKEDVIL
KEHITQLEKKLQLMVEEQDNLNKLLENEQVQKLFVKTQLYGFLKEMGSEVSEDSEEKDVV
NVLQAVGESLAKINEEKCNLAFQRDEKVLELEKEIKCLQEESVVQCEELKSLLRDYEQEK
VLLRKELEEIQSEKEALQSDLLEMKNANEKTRLENQNLLIQVEEVSQTCSKSEIHNEKEK
CFIKEHENLKPLLEQKELRDRRAELILLKDSLAKSPSVKNDPLSSVKELEEKIENLEKEC
KEKEEKINKIKLVAVKAKKELDSSRKETQTVKEELESLRSEKDQLSASMRDLIQGAESYK
NLLLEYEKQSEQLDVEKERANNFEHRIEDLTRQLRNSTLQCETINSDNEDLLARIETLQS
NAKLLEVQILEVQRAKAMVDKELEAEKLQKEQKIKEHATTVNELEELQVQLQKQKKQLQK
TMQELELVKKDAQQTTLMNMEIADYERLMKELNQKLTNKNNKIEDLEQEIKIQKQKQETL
QEEITSLQSSVQQYEEKNTKIKQLLVKTKKELADSKQAETDHLILQASLKGELEASQQQV
EVYKIQLAEITSEKHKIHEHLKTSAEQHQRTLSAYQQRVTALQEECRAAKAEQATVTSEF
ESYKVRVHNVLKQQKNKSMSQAETEGAKQEREHLEMLIDQLKIKLQDSQNNLQINVSELQ
TLQSEHDTLLERHNKMLQETVSKEAELREKLCSIQSENMMMKSEHTQTVSQLTSQNEVLR
NSFRDQVRHLQEEHRKTVETLQQQLSKMEAQLFQLKNEPTTRSPVSSQQSLKNLRERRNT
DLPLLDMHTVTREEGEGMETTDTESVSSASTYTQSLEQLLNSPETKLEPPLWHAEFTKEE
LVQKLSSTTKSADHLNGLLRETEATNAILMEQIKLLKSEIRRLERNQEREKSAANLEYLK
NVLLQFIFLKPGSERERLLPVINTMLQLSPEEKGKLAAVAQGEEENASRSSGWASYLHSW
SGLR
NT seq 5055 nt   +upstreamnt  +downstreamnt
atggaggatcttgttcaagatggggtggcttcaccagctacccctgggaccgggaaatct
aagctggaaacattgcccaaagaagacctcatcaagtttgccaagaaacagatgatgcta
atacagaaagctaaatcaaggtgtacagaattggagaaagaaattgaagaactcagatca
aaacctgttactgaaggaactggtgatattattaaggcattaactgaacgtctggatgct
cttcttctggaaaaagcagagactgagcaacagtgtctttctctgaaaaaggaaaatata
aaaatgaagcaagaggttgaggattctgtaacaaagatgggagatgcacataaggagttg
gaacaatcacatataaactatgtgaaagaaattgaaaatttgaaaaatgagttgatggca
gtacgttccaaatacagtgaagacaaagctaacttacaaaagcagctggaagaagcaatg
aatacgcaattagaactttcagaacaacttaaatttcagaacaactctgaagataatgtt
aaaaaactacaagaagagattgagaaaattaggccaggctttgaggagcaaattttatat
ctgcaaaagcaattagacgctaccactgatgaaaagaaggaaacagttactcaactccaa
aatatcattgaggctaattctcagcattaccaaaaaaatattaatagtttgcaggaagag
cttttacagttgaaagctatacaccaagaagaggtgaaagagttgatgtgccagattgaa
gcatcagctaaggaacatgaagcagagataaataagttgaacgagctaaaagagaactta
gtaaaacaatgtgaggcaagtgaaaagaacatccagaagaaatatgaatgtgagttagaa
aatttaaggaaagccacctcaaatgcaaaccaagacaatcagatatgttctattctcttg
caagaaaatacatttgtagaacaagtagtaaatgaaaaagtcaaacacttagaagatacc
ttaaaagaacttgaatctcaacacagtatcttaaaagatgaggtaacttatatgaataat
cttaagttaaaacttgaaatggatgctcaacatataaaggatgagttttttcatgaacgg
gaagacttagagtttaaaattaatgaattattactagctaaagaagaacagggctgtgta
attgaaaaattaaaatctgagctagcaggtttaaataaacagttttgctatactgtagaa
cagcataacagagaagtacagagtcttaaggaacaacatcaaaaagaaatatcagaacta
aatgagacatttttgtcagattcagaaaaagaaaaattaacattaatgtttgaaatacag
ggtcttaaggaacagtgtgaaaacctacagcaagaaaagcaagaagcaattttaaattat
gagagtttacgagagattatggaaattttacaaacagaactgggggaatctgctggaaaa
ataagtcaagagttcgaatcaatgaagcaacagcaagcatctgatgttcatgaactgcag
cagaagctcagaactgcttttactgaaaaagatgcccttctcgaaactgtgaatcgcctc
cagggagaaaatgaaaagttactatctcaacaagaattggtaccagaacttgaaaatacc
ataaagaaccttcaagaaaagaatggagtatacttacttagtctcagtcaaagagatacc
atgttaaaagaattagaaggaaagataaattctcttactgaggaaaaagatgattttata
aataaactgaaaaattcccatgaagaaatggataatttccataagaaatgtgaaagggaa
gaaagattgattcttgaacttgggaagaaagtagagcaaacaatccagtacaacagtgaa
ctagaacaaaaggtaaatgaattaacaggaggactagaggagactttaaaagaaaaggat
caaaatgaccaaaaactagaaaaacttatggttcaaatgaaagttctctctgaagacaaa
gaagtattgtcagctgaagtgaagtctctttatgaggaaaacaataaactcagttcagaa
aaaaaacagttgagtagggatttggaggtttttttgtctcaaaaagaagatgttatcctt
aaagaacatattactcaattagaaaagaaacttcagttaatggttgaagagcaagataat
ttaaataaactgcttgaaaatgagcaagttcagaagttatttgttaaaactcagttgtat
ggttttcttaaagaaatgggatcagaagtttcagaagacagtgaagagaaagatgttgtt
aatgtcctacaggcagtcggtgaatccttggcaaaaataaatgaggaaaaatgcaacctg
gcttttcagcgtgatgaaaaagtattagagttagaaaaagagattaagtgccttcaagaa
gagagtgtagttcagtgtgaagaacttaagtctttattgagagactatgagcaagagaaa
gttctcttaaggaaagagttagaagaaatacagtcagaaaaagaggccctgcagtctgat
cttctagaaatgaagaatgctaatgaaaaaacaaggcttgaaaatcagaatcttttaatt
caagttgaagaagtatctcaaacatgtagcaaaagtgaaatccataatgaaaaagaaaaa
tgttttataaaggaacatgaaaacctaaagccactactagaacaaaaagaattacgagat
aggagagcagagttgatactattaaaggattccttagcaaaatcaccttctgtaaaaaat
gatcctctgtcttcagtaaaagagttggaagaaaaaatagaaaatctggaaaaagaatgc
aaagaaaaggaggagaaaataaataagataaaattagttgccgtaaaggcaaagaaagaa
ctagattccagcagaaaagagacccagactgtgaaggaagaacttgaatctcttcgatca
gaaaaggaccagttatctgcttccatgagagatctcattcaaggagcagaaagctataag
aatcttttattagaatatgaaaagcagtcagagcaactggatgtggaaaaagaacgtgct
aataattttgagcatcgtattgaagaccttacaagacaattaagaaattcgactttgcag
tgtgaaacaataaattctgataatgaagatctcctggctcgtattgagacattacagtct
aatgccaaattattagaagtacagattttagaagtccagagagccaaagcaatggtagac
aaagaattagaagctgaaaaacttcagaaagaacagaagataaaggaacatgccactact
gtaaatgaacttgaagaacttcaggtacaacttcaaaagcaaaagaaacagcttcagaaa
accatgcaagaattagagctggttaaaaaggatgcccaacaaaccacattgatgaatatg
gaaatagctgattatgaacgtttgatgaaagaactaaatcaaaagttaactaataaaaac
aacaagatagaagatttggagcaagaaataaaaattcaaaaacagaaacaagaaacccta
caagaagaaataacttcattacagtcttcagtacaacaatatgaagaaaaaaacaccaaa
atcaagcaattgcttgtgaaaaccaaaaaggaactggcagattcaaagcaagcagaaact
gatcacttaatacttcaagcatctttaaaaggtgagctggaggcaagccagcagcaagta
gaagtctataaaatacagctggctgaaataacatcagagaagcacaaaatccacgagcac
ctgaaaacctctgcggaacagcaccagcgtacgctaagtgcataccagcagagagtgaca
gcactacaggaagagtgccgtgctgccaaggcagaacaagctactgtaacctctgaattc
gagagctacaaagtccgagttcataatgttctaaaacaacagaaaaataaatctatgtct
caggctgaaactgagggcgctaaacaagaaagggaacatctggaaatgctgattgaccag
ctaaaaatcaaattacaagatagccaaaataacttacagattaatgtatctgaacttcaa
acattgcagtctgaacatgatacactgctagaaaggcacaacaagatgctgcaggaaact
gtgtccaaagaggcggaactccgggaaaaattgtgttcaatacagtcagagaacatgatg
atgaaatctgaacatacacagactgtgagtcagctaacatcccagaacgaggtccttcga
aatagcttccgagatcaagtgcgacatttgcaggaagaacacagaaagacagtggagaca
ttacagcagcagctctccaagatggaagcacagctcttccagcttaagaatgaaccgacc
acaagaagcccagtttcctctcaacaatctttgaagaaccttcgagaaaggagaaacaca
gacctcccgcttctagacatgcacactgtaacccgggaagagggagaaggcatggagaca
actgatacggagtctgtgtcttccgccagcacatacacacagtctttagagcagctgctt
aactctcccgaaactaaacttgagcctccattatggcatgctgaatttaccaaagaagaa
ttggttcagaagctcagttccaccacaaaaagtgcagatcacttaaacggcctgcttcgg
gaaacagaagcaaccaatgcaattcttatggagcaaattaagcttctcaaaagtgaaata
agaagattggaaaggaatcaagagcgagagaagtctgcagctaacctggaatacttgaag
aacgtcttgctgcagttcattttcttgaaaccaggtagtgaaagagagagacttcttcct
gttataaatacgatgttgcagctcagccctgaagaaaagggaaaacttgctgcggttgct
caaggtgaggaagaaaatgcttcccgttcttctggatgggcatcctatcttcatagttgg
tctggacttcgatag

DBGET integrated database retrieval system