KEGG   Homo sapiens (human): 965Help
Entry
965               CDS       T01001                                 

Gene name
CD58, LFA-3, LFA3, ag3
Definition
(RefSeq) CD58 molecule
  KO
K06492  CD58 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa05169  Epstein-Barr virus infection
Drug target
Alefacept: D02800
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    965 (CD58)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05169 Epstein-Barr virus infection
    965 (CD58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    965 (CD58)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    965 (CD58)
CD molecules [BR:hsa04090]
 Proteins
  965 (CD58)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  965 (CD58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Botulinum_HA-17 Ig_3 LptF_LptG V-set
Motif
Other DBs
NCBI-GeneID: 965
NCBI-ProteinID: NP_001770
OMIM: 153420
HGNC: 1688
Ensembl: ENSG00000116815
Vega: OTTHUMG00000022749
Pharos: P19256(Tbio)
UniProt: P19256
Structure
PDB: 

Position
1p13.1
AA seq 250 aa AA seqDB search
MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQK
DKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYV
LESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMEND
LPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKC
DRKPDRTNSN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggttgctgggagcgacgcggggcgggccctgggggtcctcagcgtggtctgcctgctg
cactgctttggtttcatcagctgtttttcccaacaaatatatggtgttgtgtatgggaat
gtaactttccatgtaccaagcaatgtgcctttaaaagaggtcctatggaaaaaacaaaag
gataaagttgcagaactggaaaattctgaattcagagctttctcatcttttaaaaatagg
gtttatttagacactgtgtcaggtagcctcactatctacaacttaacatcatcagatgaa
gatgagtatgaaatggaatcgccaaatattactgataccatgaagttctttctttatgtg
cttgagtctcttccatctcccacactaacttgtgcattgactaatggaagcattgaagtc
caatgcatgataccagagcattacaacagccatcgaggacttataatgtactcatgggat
tgtcctatggagcaatgtaaacgtaactcaaccagtatatattttaagatggaaaatgat
cttccacaaaaaatacagtgtactcttagcaatccattatttaatacaacatcatcaatc
attttgacaacctgtatcccaagcagcggtcattcaagacacagatatgcacttataccc
ataccattagcagtaattacaacatgtattgtgctgtatatgaatggtattctgaaatgt
gacagaaaaccagacagaaccaactccaattga

DBGET integrated database retrieval system