KEGG   Homo sapiens (human): 9652
Entry
9652              CDS       T01001                                 

Symbol
TTC37, KIAA0372, Ski3, THES
Name
(RefSeq) tetratricopeptide repeat domain 37
  KO
K12600  superkiller protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
Disease
H01805  Tricho-hepato-enteric syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    9652 (TTC37)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    9652 (TTC37)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ski complex
     9652 (TTC37)
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_8 TPR_19 TPR_16 TPR_14 TPR_11 TPR_12 TPR_17 ANAPC3 TPR_9 TPR_15 TPR_7 Fis1_TPR_C Sel1 TPR_20 TPR_6 TPR_5 Coatomer_E PknG_TPR BTAD HrpB1_HrpK Retrotran_gag_2
Other DBs
NCBI-GeneID: 9652
NCBI-ProteinID: NP_055454
OMIM: 614589
HGNC: 23639
Ensembl: ENSG00000198677
Vega: OTTHUMG00000121165
Pharos: Q6PGP7(Tdark)
UniProt: Q6PGP7
Position
5q15
AA seq 1564 aa
MSSKEVKTALKSARDAIRNKEYKEALKHCKTVLKQEKNNYNAWVFIGVAAAELEQPDQAQ
SAYKKAAELEPDQLLAWQGLANLYEKYNHINAKDDLPGVYQKLLDLYESVDKQKWCDVCK
KLVDLYYQEKKHLEVARTWHKLIKTRQEQGAENEELHQLWRKLTQFLAESTEDQNNETQQ
LLFTAFENALGLSDKIPSEDHQVLYRHFIQSLSKFPHESARLKKACEGMINIYPTVQYPL
EVLCLHLIESGNLTDEGQQYCCRLVEMDSKSGPGLIGLGIKALQDKKYEDAVRNLTEGLK
ESPVCTSGWYHLAEAQVKMHRPKEAVLSCSQALKIVDNLGASGNSLYQRNLCLHLKAEAL
IKLSDYDSSEEAIRTLDQISDADNIPGLLVLKSLAYRNKGSFDEAAKIMEDLLSSYPDLA
EVHALEALIHFTKKDYLQAEKCFQRALEKDTEVAEYHYQLGLTYWFMGEETRKDKTKALT
HFLKAARLDTYMGKVFCYLGHYYRDVVGDKNRARGCYRKAFELDDTDAESGAAAVDLSVE
LEDMEMALAILTTVTQKASAGTAKWAWLRRGLYYLKAGQHSQAVADLQAALRADPKDFNC
WESLGEAYLSRGGYTTALKSFTKASELNPESIYSVFKVAAIQQILGKYKEAVAQYQMIIK
KKEDYVPALKGLGECHLMMAKAALVDYLDGKAVDYIEKALEYFTCALQHRADVSCLWKLA
GDACTCLYAVAPSKVNVHVLGVLLGQKEGKQVLKKNELLHLGGRCYGRALKLMSTSNTWC
DLGINYYRQAQHLAETGSNMNDLKELLEKSLHCLKKAVRLDSNNHLYWNALGVVACYSGI
GNYALAQHCFIKSIQSEQINAVAWTNLGVLYLTNENIEQAHEAFKMAQSLDPSYLMCWIG
QALIAEAVGSYDTMDLFRHTTELNMHTEGALGYAYWVCTTLQDKSNRETELYQYNILQMN
AIPAAQVILNKYVERIQNYAPAFTMLGYLNEHLQLKKEAANAYQRAILLLQTAEDQDTYN
VAIRNYGRLLCSTGEYDKAIQAFKSTPLEVLEDIIGFALALFMKGLYKESSKAYERALSI
VESEQDKAHILTALAITEYKQGKTDVAKTLLFKCSILKEPTTESLQALCALGLAMQDATL
SKAALNELLKHIKHKDSNYQRCLLTSAIYALQGRSVAVQKQISKAVHSNPGDPALWSLLS
RVVAQYAQRNAKGGVVAGNVAHILDSNHGKKALLYTAVNQLAMGSSSAEDEKNTALKTIQ
KAALLSPGDPAIWAGLMAACHADDKLALVNNTQPKRIDLYLALLSAVSASIKDEKFFENY
NQSLEKWSLSQAVTGLIDTGRISEAETLCTKNLKSNPDQPAVILLLRQVQCKPLLESQKP
LPDAVLEELQKTVMSNSTSVPAWQWLAHVYQSQGMMRAAEMCYRKSLQLASQRGSWSGKL
SSLLRLALLALKVCMANISNDHWPSLVQEATTEALKLCFCPLAVLLQALLQFKRKMGARE
TRRLLERVVYQPGYPKSIASTARWYLLRHLYAKDDYELIDVLVNNAKTHGDTRALELNQR
LSSQ
NT seq 4695 nt   +upstreamnt  +downstreamnt
atgtccagcaaggaagtgaagactgctctaaaaagtgctagagatgcaatcagaaacaaa
gaatacaaagaagctttgaaacactgtaagacagtgttaaagcaagagaaaaataactat
aatgcctgggtttttattggcgttgctgcagctgaactagaacaacctgatcaggcccag
agtgcctataaaaaagctgctgaattagagccagaccaattactagcttggcaggggtta
gcaaacttgtatgagaaatataatcacataaatgctaaggatgacttgcctggtgtttac
caaaagctcctggatctttatgagagtgttgacaagcagaagtggtgtgatgtctgcaag
aaacttgtggatctatattaccaagaaaagaaacacctagaggtggctcgaacatggcac
aagttgataaaaacacggcaggaacaaggtgcagaaaatgaagagcttcatcaactatgg
agaaaattgactcagttcctggctgaaagtacagaggaccagaataatgaaactcagcaa
ttgctttttactgcttttgagaatgcactgggattatcagataagattcctagtgaagat
caccaagtactttataggcatttcattcagagtttatccaaatttcctcatgagtctgct
agattgaagaaggcctgtgaaggaatgataaacatctatcctactgtacagtatccatta
gaagtgctttgtttgcatttaattgaatcaggaaatcttactgatgaggggcagcagtat
tgttgtagattagtggaaatggattcaaaaagtggtccaggcctcattggcttaggcatt
aaagcattacaagacaaaaagtatgaagatgctgttaggaacctaacagaagggttaaag
gaaagccctgtctgcacaagtggatggtatcatctggcagaagcccaagtcaaaatgcat
agacctaaagaagctgttctttcatgcagtcaagctctgaagatcgtagataatcttggt
gcgtctggtaacagtctttatcagaggaatctttgtcttcatttgaaagcagaggctttg
attaaactctcagattatgactcttcagaggaagcaattcgtacgcttgatcagatttct
gatgcagataatatcccaggacttttggttctcaaaagcttggcctatcggaacaaaggt
tcatttgatgaagctgcaaagattatggaagaccttctctcttcttaccctgacctagct
gaagttcatgcccttgaggctttgattcatttcaccaaaaaggactatctacaagcagaa
aaatgttttcagagagctcttgagaaagataccgaagttgcagaatatcattaccaactt
ggattaacatactggttcatgggtgaagagacaagaaaagataaaacaaaggctcttacc
cactttctgaaggctgcaagactggatacatatatgggcaaagttttctgctatttaggt
cattattatagagacgtagtgggagataaaaacagagctcgtggatgttataggaaagcc
tttgaattagatgacactgatgctgaatctggagctgcagcagttgacctaagtgtggag
cttgaagatatggaaatggctttagctatcctaacaacagtaactcaaaaggcaagtgct
ggaacggcaaaatgggcctggcttaggcgaggactatactatttgaaagctggtcagcat
tctcaagcagtggctgatttacaggcagcattaagagcagacccaaaggacttcaattgt
tgggaatcgttaggagaagcatacttaagcagaggaggctacacaacagccttgaagtcc
ttcacaaaagccagtgagctgaacccagaatccatatacagtgtgtttaaggttgcagca
atacagcaaatcctaggcaaatataaggaggctgtagctcaataccagatgatcattaaa
aagaaagaagattatgtgcctgctttaaaaggtttgggtgaatgccatcttatgatggca
aaagcagctctagttgattatcttgatggaaaagccgtagactacatagaaaaagcactg
gaatattttacttgtgctctacagcatcgagctgatgtgtcctgcctctggaagctagct
ggggatgcttgtacctgtctgtatgctgtcgcaccatctaaagtgaatgttcatgtttta
ggagtccttctaggtcagaaagaaggaaaacaagtattaaagaaaaatgagctcctccac
cttggaggaaggtgttatggtcgtgcattaaaactgatgtctacatctaatacatggtgt
gaccttggaattaattattatcgccaagcacaacatctagcagaaacaggcagcaacatg
aatgatcttaaggagttgctggagaaatctttacattgtctgaaaaaagcagtgagactc
gacagtaataatcacttatactggaatgctcttggtgtggttgcatgttacagtggtatt
ggaaattatgcccttgctcagcactgtttcatcaaatcaatccagtcagaacaaattaat
gctgttgcatggaccaacttgggagtgttatacctcacaaatgaaaacattgagcaagct
catgaggctttcaaaatggctcaatcccttgatccatcttatttaatgtgctggattgga
caagctcttattgctgaggcagttggaagttatgacaccatggatctcttcaggcacact
acagaactaaatatgcatactgaaggagcattaggttatgcgtattgggtctgcacaaca
ttgcaagataaaagcaacagagaaacagagctgtaccagtacaacatcctccagatgaat
gctattccagcagcacaagttattttgaataaatatgtagaaagaattcagaattatgcc
ccagctttcacaatgttgggttacttaaacgaacatctacaactgaaaaaggaagcagca
aatgcataccaaagggcaattttgttgttacagactgcagaagaccaagatacttacaat
gttgcaataagaaattacggcagattgttatgttccactggtgaatatgataaagctatc
caggcttttaagtcaacaccccttgaagtgttagaagacatcataggttttgcattggct
ttattcatgaaggggctttataaagagagcagcaaagcctatgagagagccttgtctatt
gttgaatcggagcaagacaaagcccatatcttgacagctctggcaataactgaatataaa
caaggaaaaacggatgtagccaagacattgctatttaaatgctctatcttaaaggaacca
accacagaaagccttcaagccctgtgtgctctagggttggcaatgcaggatgctacactg
tcaaaagcagcacttaatgagttactgaagcacatcaaacacaaagacagtaattatcag
aggtgccttcttacatcagcgatttatgcactccaaggccgcagtgtggctgtgcaaaaa
caaatatctaaagctgttcacagcaaccctggtgaccctgctctttggtctctgttgtct
cgagttgttgcacagtatgctcaacgaaatgcaaagggaggtgttgtagcaggaaatgtg
gctcatattctggactcaaatcatggaaagaaggcattactgtacactgcggtaaatcag
ttggctatgggaagcagttcagcagaagatgaaaaaaatactgcactaaagaccattcag
aaggcagctctcctttctccaggtgatcctgctatctgggctgggctaatggcagcctgt
cacgctgatgataaactggccttagtgaacaacactcagccaaagaggatagatttatac
ttggcactgttatctgctgtttctgcttcaattaaagacgaaaaattctttgaaaattac
aaccagtcccttgaaaagtggtctctctcacaagctgtcactggtctaatagacacagga
agaatatctgaagctgaaactctctgcacaaagaatttaaaaagtaaccctgatcagcca
gccgttatcttacttttgagacaagttcagtgtaaaccactcctggagtcacaaaagcca
ctcccagatgctgtacttgaagaactacaaaaaacagtcatgtccaactcaacctctgtt
ccagcttggcagtggctggcacatgtgtatcaatcccaaggaatgatgagagctgcagag
atgtgttacagaaagagtctacaattggcatcccaacggggcagttggagtgggaagctc
tcaagtctgttgagactagcactacttgcattaaaagtctgtatggctaacatttccaat
gatcactggccatctttggttcaagaggctacaactgaggccttgaagctttgcttttgt
ccactggctgttcttttacaagctttgttacaattcaaacgcaaaatgggggcaagagag
acacggcgtcttttggaaagagtggtatatcagcctgggtatcccaaatctattgcatca
actgcacgttggtacctactgagacacttatatgccaaagatgactatgagcttattgac
gtgctggtaaacaatgccaaaactcatggagatacaagagcattggaactgaatcagaga
ttgtcctcacaataa

DBGET integrated database retrieval system