KEGG   Homo sapiens (human): 9656Help
Entry
9656              CDS       T01001                                 

Gene name
MDC1, NFBD1
Definition
(RefSeq) mediator of DNA damage checkpoint 1
  KO
K20780  mediator of DNA damage checkpoint protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    9656 (MDC1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    9656 (MDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FHA RTT107_BRCT_5 BRCT Yop-YscD_cpl
Motif
Other DBs
NCBI-GeneID: 9656
NCBI-ProteinID: NP_055456
OMIM: 607593
HGNC: 21163
Ensembl: ENSG00000137337
Vega: OTTHUMG00000031075
Pharos: Q14676(Tbio)
UniProt: Q14676 A0A1U9XBC1 A1Z5I9
Structure
PDB: 

Position
6p21.33
AA seq 2089 aa AA seqDB search
MEDTQAIDWDVEEEEETEQSSESLRCNVEPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMP
DCSVALPFPSISKQHAEIEILAWDKAPILRDCGSLNGTQILRPPKVLSPGVSHRLRDQEL
ILFADLLCQYHRLDVSLPFVSRGPLTVEETPRVQGETQPQRLLLAEDSEEEVDFLSERRM
VKKSRTTSSSVIVPESDEEGHSPVLGGLGPPFAFNLNSDTDVEEGQQPATEEASSAARRG
ATVEAKQSEAEVVTEIQLEKDQPLVKERDNDTKVKRGAGNGVVPAGVILERSQPPGEDSD
TDVDDDSRPPGRPAEVHLERAQPFGFIDSDTDAEEERIPATPVVIPMKKRKIFHGVGTRG
PGAPGLAHLQESQAGSDTDVEEGKAPQAVPLEKSQASMVINSDTDDEEEVSAALTLAHLK
ESQPAIWNRDAEEDMPQRVVLLQRSQTTTERDSDTDVEEEELPVENREAVLKDHTKIRAL
VRAHSEKDQPPFGDSDDSVEADKSSPGIHLERSQASTTVDINTQVEKEVPPGSAIIHIKK
HQVSVEGTNQTDVKAVGGPAKLLVVSLEEAWPLHGDCETDAEEGTSLTASVVADVRKSQL
PAEGDAGAEWAAAVLKQERAHEVGAQGGPPVAQVEQDLPISRENLTDLVVDTDTLGESTQ
PQREGAQVPTGREREQHVGGTKDSEDNYGDSEDLDLQATQCFLENQGLEAVQSMEDEPTQ
AFMLTPPQELGPSHCSFQTTGTLDEPWEVLATQPFCLRESEDSETQPFDTHLEAYGPCLS
PPRAIPGDQHPESPVHTEPMGIQGRGRQTVDKVMGIPKETAERVGPERGPLERETEKLLP
ERQTDVTGEEELTKGKQDREQKQLLARDTQRQESDKNGESASPERDRESLKVEIETSEEI
QEKQVQKQTLPSKAFEREVERPVANRECDPAELEEKVPKVILERDTQRGEPEGGSQDQKG
QASSPTPEPGVGAGDLPGPTSAPVPSGSQSGGRGSPVSPRRHQKGLLNCKMPPAEKASRI
RAAEKVSRGDQESPDACLPPTVPEAPAPPQKPLNSQSQKHLAPPPLLSPLLPSIKPTVRK
TRQDGSQEAPEAPLSSELEPFHPKPKIRTRKSSRMTPFPATSAAPEPHPSTSTAQPVTPK
PTSQATRSRTNRSSVKTPEPVVPTAPELQPSTSTDQPVTSEPTSQVTRGRKSRSSVKTPE
TVVPTALELQPSTSTDRPVTSEPTSQATRGRKNRSSVKTPEPVVPTAPELQPSTSTDQPV
TSEPTYQATRGRKNRSSVKTPEPVVPTAPELRPSTSTDRPVTPKPTSRTTRSRTNMSSVK
TPETVVPTAPELQISTSTDQPVTPKPTSRTTRSRTNMSSVKNPESTVPIAPELPPSTSTE
QPVTPEPTSRATRGRKNRSSGKTPETLVPTAPKLEPSTSTDQPVTPEPTSQATRGRTNRS
SVKTPETVVPTAPELQPSTSTDQPVTPEPTSQATRGRTDRSSVKTPETVVPTAPELQASA
STDQPVTSEPTSRTTRGRKNRSSVKTPETVVPAAPELQPSTSTDQPVTPEPTSRATRGRT
NRSSVKTPESIVPIAPELQPSTSRNQLVTPEPTSRATRCRTNRSSVKTPEPVVPTAPEPH
PTTSTDQPVTPKLTSRATRRKTNRSSVKTPKPVEPAASDLEPFTPTDQSVTPEAIAQGGQ
SKTLRSSTVRAMPVPTTPEFQSPVTTDQPISPEPITQPSCIKRQRAAGNPGSLAAPIDHK
PCSAPLEPKSQASRNQRWGAVRAAESLTAIPEPASPQLLETPIHASQIQKVEPAGRSRFT
PELQPKASQSRKRSLATMDSPPHQKQPQRGEVSQKTVIIKEEEEDTAEKPGKEEDVVTPK
PGKRKRDQAEEEPNRIPSRSLRRTKLNQESTAPKVLFTGVVDARGERAVLALGGSLAGSA
AEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFG
FSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVI
TCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLSPLEMSST
NT seq 6270 nt NT seq  +upstreamnt  +downstreamnt
atggaggacacccaggctattgactgggatgttgaagaagaggaggagacagagcaatcc
agtgaatccttgaggtgtaacgtggagccagtagggcggctacatatctttagtggtgcc
catggaccagaaaaagatttcccactacacctcgggaagaatgtggtaggccgaatgcct
gactgctctgtggccctgccctttccatctatctccaaacaacatgcagagattgaaatc
ttagcctgggacaaggcacctatcctccgagactgtgggagccttaatggtactcaaatc
ctgagacctcctaaggttttgagccctggggtgagtcaccgtctgagggaccaggaattg
attctctttgctgacttgctctgccagtaccatcgcctggatgtctctctgccctttgtc
tcccggggccctctgacagtagaagagacacccagagtacagggagaaactcaaccccag
aggcttctgttggctgaggactcggaggaggaagtagattttctttctgaaaggcgtatg
gtaaaaaaatcaaggaccacatcttcctctgtgatagttccagagagtgatgaagagggg
cattccccggtcctgggcggccttgggccgccttttgccttcaatttgaacagtgacaca
gatgtggaagaaggtcagcaaccagccacagaggaggcctcctcagctgccagaagaggt
gccactgtagaggcaaagcagtctgaagctgaagttgtaactgaaatccagcttgaaaag
gatcagcctttagtgaaggagagggacaatgatacaaaagtcaagaggggtgcagggaat
ggggtggttccagctggggtgattctggagaggagccaacctcctggagaggacagtgac
acagatgtggatgatgacagcaggcctcctggaaggccagctgaggtccatttggaaagg
gctcagccttttggcttcatcgacagcgacactgatgcggaagaagagaggatcccagca
accccagttgtcattcctatgaagaagaggaagatcttccatggagtaggtacaaggggt
cctggagcaccaggcctggcccatctgcaggagagccaggctggtagtgatacagatgtg
gaagaaggcaaggccccacaggctgtccctctggagaaaagccaagcttccatggttatc
aacagcgatacagatgacgaggaagaagtctcagcagcgctgactttggcacatctgaaa
gagagccagcctgctatatggaacagagatgcagaagaggacatgccccaacgtgtggtc
cttctgcagcgaagccaaaccaccactgagagagacagtgacacagacgtggaggaggaa
gagctcccagtggaaaatagagaagctgtcctcaaggatcacacaaagattagagccctt
gttagagcacattcagaaaaggaccaacctccttttggggacagtgatgacagtgtggaa
gcagataagagctcacctgggatccacctggagagaagccaagcctccaccacagtggac
atcaacacacaagtggagaaggaagtcccgccagggtcagccattatacatataaagaag
catcaggtgtctgtggaggggacaaatcaaacagatgtgaaagcagttgggggaccagca
aagctgcttgtggtatctctagaggaagcctggcctctgcatggggactgtgaaacagat
gcagaggagggcacctccctaacagcctcagtagttgcagatgtaagaaagagccagctt
ccagcagaaggggatgctggggcagagtgggctgcagctgttcttaagcaggagagagct
catgaggtgggggcccagggtgggccacctgtggcacaagtggagcaggacctccctatc
tcaagagagaacctcacagatctggtggtggacacagacactctaggggaatccacccag
ccacagagagagggagcccaggtccccacaggaagggagagagaacaacatgtgggtggg
accaaggactctgaagacaactatggtgattctgaagatctggacctacaagctacccag
tgctttctggagaatcagggcctggaagcagtccagagcatggaggatgaacctacccag
gccttcatgttgactccaccccaagagcttggcccttcccattgcagcttccagacaaca
ggtaccctagatgaaccatgggaggtcctggctacacagccattctgtctgagagagtct
gaggactctgagacccagccttttgacacgcaccttgaggcctatggaccttgcctgtct
ccacctagggcaataccaggagaccaacatccagagagcccagttcacacagagccaatg
gggattcaaggcagagggaggcagactgtggataaagtcatgggtataccaaaagaaaca
gcagagagggtgggccctgagagagggccattggagagagaaactgagaaactgctacca
gaaagacagacagatgtgacaggagaggaagaattaaccaaggggaaacaggacagagaa
caaaaacagttgttagctagagacacccagagacaagaatctgacaaaaatggggaaagt
gcaagtcctgaaagagatagggagagtttgaaggtagaaattgagacatctgaggaaata
caagagaaacaagtacagaagcagacccttccaagcaaagcatttgagagagaagtagag
agaccagtagcaaacagagagtgcgatccagccgagttagaagagaaggtgcccaaagtg
atcctggagagagatacacagagaggggagccagagggagggagccaggaccagaaaggg
caggcctccagcccaacaccagagcctggggtgggggcgggggaccttccgggacctacc
tcagcccccgtaccttctgggagccagtcaggtggaaggggatccccagtgagccccagg
aggcatcagaaaggcctcctgaattgcaagatgccacctgctgagaaggcttccaggatc
agagctgctgagaaggtttccaggggcgatcaggaatctccagatgcttgtctgcctcct
acagtacctgaagccccagccccaccccaaaagccccttaactctcagagccagaaacat
cttgcacctccgccccttctttctccccttttaccttctatcaagccaaccgttcgtaag
accaggcaagatgggagtcaggaagctccagaggctcccttgtcctcagagctggagcct
ttccacccaaagcctaaaattagaactcggaagtcctccagaatgacaccctttccagct
acctctgctgcccctgagccccacccttccacctccacagcccagccagtcactcccaag
cccacatctcaggccactaggagcaggacaaataggtcctctgtcaagacccctgaacca
gttgtccccacagcccctgagctccagccttccacctccacagaccagcctgtcacctct
gagcccacatctcaggttactaggggaagaaaaagtagatcctctgtcaagacccctgaa
acagttgtgcccacagcccttgagctccagccttccacctccaccgaccgacctgtcacc
tctgaacccacctctcaggctactaggggaagaaaaaatagatcctctgtcaagacccct
gaaccagttgtccccacagcccctgagctccagccttccacctccacagaccagcctgtc
acttctgagcccacatatcaggctactaggggaagaaaaaatagatcctctgtcaagacc
cctgaaccagttgtgcccacagcccctgagctccggccttccacctccacagaccgacct
gtcacccccaagcccacatctcggaccactaggagcaggacaaatatgtcctctgtcaag
acccctgaaacagttgtccccacagcccctgagctccagatttccacctccacagaccaa
cctgtcacccctaagcccacatctcggaccactaggagcaggacaaatatgtcctctgtg
aagaaccctgaatcaactgtccctatagcccctgagctcccaccttccacctccacagag
cagcctgtcacccctgagcccacatctcgggctactaggggaagaaaaaatagatcctct
ggcaagacccctgaaacacttgtccccacagcccctaagctcgagccttccacttccaca
gaccaacctgtcactcctgagcccacatctcaggccaccaggggcaggacaaataggtcc
tctgtgaagacccctgaaacagttgtccccacagcccctgagctccagccttccacctcc
acagaccagcctgttacccctgagcctacgtctcaggctactaggggaagaacagataga
tcctctgtcaagactcctgaaacagttgtccccacagcccctgagctacaggcttccgcc
tccacagaccagcctgtcacctctgagcccacatctcggaccactaggggaagaaaaaat
cggtcctctgtcaagacccctgaaacagttgtgcccgcagcccctgagctccagccttcc
acctccacagaccaacctgtcacccctgagcccacatctcgggccactaggggcaggaca
aataggtcctctgtcaagacccctgaatcaattgtccctatagcccctgagcttcagcct
tccacctccagaaaccagcttgtcacccctgagcccacatctcgggccactaggtgcagg
acaaataggtcctctgtcaagacccctgagccagttgtccccacagcccctgagccccat
cctaccacctccacagaccagcctgtcacccccaagctcacatctagggccactaggaga
aagacaaataggtcctctgtcaagactcccaaaccagttgaaccagcagcctctgatctt
gagccttttacccccacagaccagtccgtcacccctgaggccatagctcagggtggtcag
agcaaaacactgaggtcttccacagtaagagctatgccggttcctaccacccctgaattc
caatctcctgtcaccacagaccagcctatttcccctgagcctattactcaacccagttgc
atcaagaggcagagagccgctgggaaccctggctccctcgcagctcccattgaccataag
ccttgctctgcacccttggaacctaaatcccaggcctcaaggaaccaaagatggggagca
gtgagagcagctgaatcccttacagccattcctgagcctgcctctccccagcttcttgag
acaccaattcatgcctcccagatccaaaaggtggaaccagcaggtagatctaggttcacc
ccggagctccagcctaaggcctctcaaagccgcaagaggtctttagctaccatggattca
ccaccacatcaaaaacagccccaaagaggggaagtctcccagaagacagtgattatcaag
gaagaggaagaagatactgcagagaagccagggaaggaagaggatgtcgtgactccaaaa
ccaggcaagagaaagagagaccaggcagaggaggagcccaacagaataccaagccgcagc
ctccgacggaccaaacttaaccaagaatcaacagcccccaaagtgctcttcacaggagtg
gtggatgctcggggagagcgggctgtgctggcactggggggaagtctggctggttcagcg
gcagaggcttcccacctggtcactgatcgcatccgccggacagtcaagttcctgtgtgcc
ctggggcggggaatccccattctgtccctggactggctgcatcagtcccgcaaggctggt
ttcttcttacccccggatgaatatgtggtgaccgaccctgagcaagagaagaactttggc
tttagccttcaagacgcactgagcagggctcgggagcgaaggctgctagagggctatgag
atctatgtgacccctggagtccagccaccaccacctcagatgggagagattattagctgc
tgtggaggcacatacctacccagcatgcctcggtcctataagcctcagagagttgtgatc
acatgccctcaggacttccctcattgctccattccactacgggttgggctgcccctcctc
tcgcctgagttcctgctgactggagtgctgaagcaggaagccaagccagaggcctttgtc
ctctcccctttggagatgtcatccacctga

DBGET integrated database retrieval system