KEGG   Homo sapiens (human): 966Help
Entry
966               CDS       T01001                                 

Gene name
CD59, 16.3A5, 1F5, EJ16, EJ30, EL32, G344, HRF-20, HRF20, MAC-IP, MACIF, MEM43, MIC11, MIN1, MIN2, MIN3, MIRL, MSK21, p18-20
Definition
(RefSeq) CD59 molecule (CD59 blood group)
  KO
K04008  CD59 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04640  Hematopoietic cell lineage
Disease
H00106  Complement regulatory protein defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    966 (CD59)
   04610 Complement and coagulation cascades
    966 (CD59)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    966 (CD59)
   04090 CD molecules [BR:hsa04090]
    966 (CD59)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    966 (CD59)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   966 (CD59)
  Exosomal proteins of other body fluids (saliva and urine)
   966 (CD59)
  Exosomal proteins of colorectal cancer cells
   966 (CD59)
CD molecules [BR:hsa04090]
 Proteins
  966 (CD59)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  966 (CD59)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPAR_LY6
Motif
Other DBs
NCBI-GeneID: 966
NCBI-ProteinID: NP_000602
OMIM: 107271
HGNC: 1689
Ensembl: ENSG00000085063
Vega: OTTHUMG00000166270
Pharos: P13987(Tbio)
UniProt: P13987 Q6FHM9
Structure
PDB: 

Position
11p13
AA seq 128 aa AA seqDB search
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQV
YNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFL
AAAWSLHP
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgggaatccaaggagggtctgtcctgttcgggctgctgctcgtcctggctgtcttctgc
cattcaggtcatagcctgcagtgctacaactgtcctaacccaactgctgactgcaaaaca
gccgtcaattgttcatctgattttgatgcgtgtctcattaccaaagctgggttacaagtg
tataacaagtgttggaagtttgagcattgcaatttcaacgacgtcacaacccgcttgagg
gaaaatgagctaacgtactactgctgcaagaaggacctgtgtaactttaacgaacagctt
gaaaatggtgggacatccttatcagagaaaacagttcttctgctggtgactccatttctg
gcagcagcctggagccttcatccctaa

DBGET integrated database retrieval system