KEGG   Homo sapiens (human): 9669
Entry
9669              CDS       T01001                                 

Symbol
EIF5B, IF2
Name
(RefSeq) eukaryotic translation initiation factor 5B
  KO
K03243  translation initiation factor 5B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    9669 (EIF5B)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-5
    9669 (EIF5B)
SSDB
Motif
Pfam: GTP_EFTU IF-2 GTP_EFTU_D4 GTP_EFTU_D2 MMR_HSR1 Roc ATP_bind_1
Other DBs
NCBI-GeneID: 9669
NCBI-ProteinID: NP_056988
OMIM: 606086
HGNC: 30793
Ensembl: ENSG00000158417
Vega: OTTHUMG00000153242
Pharos: O60841(Tbio)
UniProt: O60841 Q8N5A0
Position
2q11.2
AA seq 1220 aa
MGKKQKNKSEDSTKDDIDLDALAAEIEGAGAAKEQEPQKSKGKKKKEKKKQDFDEDDILK
ELEELSLEAQGIKADRETVAVKPTENNEEEFTSKDKKKKGQKGKKQSFDDNDSEELEDKD
SKSKKTAKPKVEMYSGSDDDDDFNKLPKKAKGKAQKSNKKWDGSEEDEDNSKKIKERSRI
NSSGESGDESDEFLQSRKGQKKNQKNKPGPNIESGNEDDDASFKIKTVAQKKAEKKERER
KKRDEEKAKLRKLKEKEELETGKKDQSKQKESQRKFEEETVKSKVTVDTGVIPASEEKAE
TPTAAEDDNEGDKKKKDKKKKKGEKEEKEKEKKKGPSKATVKAMQEALAKLKEEEERQKR
EEEERIKRLEELEAKRKEEERLEQEKRERKKQKEKERKERLKKEGKLLTKSQREARARAE
ATLKLLQAQGVEVPSKDSLPKKRPIYEDKKRKKIPQQLESKEVSESMELCAAVEVMEQGV
PEKEETPPPVEPEEEEDTEDAGLDDWEAMASDEETEKVEGNKVHIEVKENPEEEEEEEEE
EEEDEESEEEEEEEGESEGSEGDEEDEKVSDEKDSGKTLDKKPSKEMSSDSEYDSDDDRT
KEERAYDKAKRRIEKRRLEHSKNVNTEKLRAPIICVLGHVDTGKTKILDKLRHTHVQDGE
AGGITQQIGATNVPLEAINEQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLC
DIAILVVDIMHGLEPQTIESINLLKSKKCPFIVALNKIDRLYDWKKSPDSDVAATLKKQK
KNTKDEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVE
LTQTMLSKRLAHCEELRAQVMEVKALPGMGTTIDVILINGRLKEGDTIIVPGVEGPIVTQ
IRGLLLPPPMKELRVKNQYEKHKEVEAAQGVKILGKDLEKTLAGLPLLVAYKEDEIPVLK
DELIHELKQTLNAIKLEEKGVYVQASTLGSLEALLEFLKTSEVPYAGINIGPVHKKDVMK
ASVMLEHDPQYAVILAFDVRIERDAQEMADSLGVRIFSAEIIYHLFDAFTKYRQDYKKQK
QEEFKHIAVFPCKIKILPQYIFNSRDPIVMGVTVEAGQVKQGTPMCVPSKNFVDIGIVTS
IEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRD
EMQKSDWQLIVELKKVFEII
NT seq 3663 nt   +upstreamnt  +downstreamnt
atggggaagaaacagaaaaacaagagcgaagacagcaccaaggatgacattgatcttgat
gccttggctgcagaaatagaaggagctggtgctgccaaagaacaggagcctcaaaagtca
aaagggaaaaagaaaaaagagaaaaaaaagcaggactttgatgaagatgatatcctgaaa
gaactggaagaattgtctttggaagctcaaggcatcaaagctgacagagaaactgttgca
gtgaagccaacagaaaacaatgaagaggaattcacctcaaaagataaaaaaaagaaagga
cagaagggcaaaaaacagagttttgatgataatgatagcgaagaattggaagataaagat
tcaaaatcaaaaaagactgcaaaaccgaaagtggaaatgtactctgggagtgatgatgat
gatgattttaacaaacttcctaaaaaagctaaagggaaagctcaaaaatcaaataagaag
tgggatgggtcagaggaggatgaggataacagtaaaaaaattaaagagcgttcaagaata
aattcttctggtgaaagtggtgatgaatcagatgaatttttgcaatctagaaaaggacag
aaaaaaaatcagaaaaacaagccaggtcctaacatagaaagtgggaatgaagatgatgac
gcctccttcaaaattaagacagtggcccaaaagaaggcagaaaagaaggagcgcgagaga
aaaaagcgagatgaagaaaaagcgaaactgcggaagctgaaagaaaaagaagagttagaa
acaggtaaaaaggatcagagtaaacaaaaggaatctcaaaggaaatttgaagaagaaact
gtaaaatccaaagtgactgttgatactggagtaattcctgcctctgaagagaaagcagag
actcccacagctgcagaagatgacaatgaaggagacaaaaagaagaaagataagaagaaa
aagaaaggagaaaaggaagaaaaagagaaagagaagaaaaaaggacctagcaaagccact
gttaaagctatgcaagaagctctggctaagcttaaagaggaagaagaaagacagaagaga
gaagaggaagaacgtataaaacggcttgaagaattagaagccaagcgtaaagaagaggaa
cgattggaacaagaaaaaagagaaaggaaaaagcaaaaagaaaaagaaagaaaagaacgc
ttgaaaaaagaagggaaacttttaactaaatcccagagagaagccagagccagagccgaa
gctactcttaaactgctacaagctcagggtgttgaagtgccatcaaaagactctttgcca
aagaagaggccaatttatgaagataaaaagaggaaaaaaataccacagcagctagaaagt
aaagaagtgtctgaatcaatggaattatgtgctgctgtagaagttatggaacaaggagta
ccagaaaaggaagagacaccacctcctgttgaaccagaagaagaagaagatactgaggat
gctggattggatgattgggaagctatggccagtgatgaggagacagaaaaagtagaagga
aacaaagttcatatagaagtaaaagaaaaccctgaagaggaggaggaggaggaagaagag
gaagaagaagatgaagaaagtgaagaagaggaggaagaggagggagaaagtgaaggcagt
gaaggtgatgaggaagatgaaaaggtgtcagatgagaaggattcagggaagacattagat
aaaaagccaagtaaagaaatgagctcagattctgaatatgactctgatgatgatcggact
aaagaagaaagggcttatgacaaagcaaaacggaggattgagaaacggcgacttgaacat
agtaaaaatgtaaacaccgaaaagctaagagcccctattatctgcgtacttgggcatgtg
gacacagggaagacaaaaattctagataagctccgtcacacacatgtacaagatggtgaa
gcaggtggtatcacacaacaaattggggccaccaatgttcctcttgaagctattaatgaa
cagactaagatgattaaaaattttgatagagagaatgtacggattccaggaatgctaatt
attgatactcctgggcatgaatctttcagtaatctgagaaatagaggaagctctctttgt
gacattgccattttagttgttgatattatgcatggtttggagccccagacaattgagtct
atcaaccttctcaaatctaaaaaatgtcccttcattgttgcactcaataagattgatagg
ttatatgattggaaaaagagtcctgactctgatgtggctgctactttaaagaagcagaaa
aagaatacaaaagatgaatttgaggagcgagcaaaggctattattgtagaatttgcacag
cagggtttgaatgctgctttgttttatgagaataaagatccccgcacttttgtgtctttg
gtacctacctctgcacatactggtgatggcatgggaagtctgatctaccttcttgtagag
ttaactcagaccatgttgagcaagagacttgcacactgtgaagagctgagagcacaggtg
atggaggttaaagctctcccggggatgggcaccactatagatgtcatcttgatcaatggg
cgtttgaaggaaggagatacaatcattgttcctggagtagaagggcccattgtaactcag
attcgaggcctcctgttacctcctcctatgaaggaattacgagtgaagaaccagtatgaa
aagcataaagaagtagaagcagctcagggggtaaagattcttggaaaagacctggagaaa
acattggctggtttacccctccttgtggcttataaagaagatgaaatccctgttcttaaa
gatgaattgatccatgagttaaagcagacactaaatgctatcaaattagaagaaaaagga
gtctatgtccaggcatctacactgggttctttggaagctctactggaatttctgaaaaca
tcagaagtgccctatgcaggaattaacattggcccagtgcataaaaaagatgttatgaag
gcttcagtgatgttggaacatgaccctcagtatgcagtaattttggccttcgatgtgaga
attgaacgagatgcacaagaaatggctgatagtttaggagttagaatttttagtgcagaa
attatttatcatttatttgatgcctttacaaaatatagacaagactacaagaaacagaaa
caagaagaatttaagcacatagcagtatttccctgcaagataaaaatcctccctcagtac
atttttaattctcgagatccgatagtgatgggggtgacggtggaagcaggtcaggtgaaa
caggggacacccatgtgtgtcccaagcaaaaattttgttgacatcggaatagtaacaagt
attgaaataaaccataaacaagtggatgttgcaaaaaaaggacaagaagtttgtgtaaaa
atagaacctatccctggtgagtcacccaaaatgtttggaagacattttgaagctacagat
attcttgttagtaagatcagccggcagtccattgatgcactcaaagactggttcagagat
gaaatgcagaagagtgactggcagcttattgtggagctgaagaaagtatttgaaatcatc
taa

DBGET integrated database retrieval system