KEGG   Homo sapiens (human): 9672Help
Entry
9672              CDS       T01001                                 

Gene name
SDC3, SDCN, SYND3
Definition
(RefSeq) syndecan 3
  KO
K16337  syndecan 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Disease
H02106  Genetic obesity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    9672 (SDC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    9672 (SDC3)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   9672 (SDC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syndecan
Motif
Other DBs
NCBI-GeneID: 9672
NCBI-ProteinID: NP_055469
OMIM: 186357
HGNC: 10660
Ensembl: ENSG00000162512
Vega: OTTHUMG00000043646
Pharos: O75056(Tbio)
UniProt: O75056
Position
1p35.2
AA seq 442 aa AA seqDB search
MKPGPPHRAGAAHGAGAGAGAAAGPGARGLLLPPLLLLLLAGRAAGAQRWRSENFERPVD
LEGSGDDDSFPDDELDDLYSGSGSGYFEQESGIETAMRFSPDVALAVSTTPAVLPTTNIQ
PVGTPFEELPSERPTLEPATSPLVVTEVPEEPSQRATTVSTTMATTAATSTGDPTVATVP
ATVATATPSTPAAPPFTATTAVIRTTGVRRLLPLPLTTVATARATTPEAPSPPTTAAVLD
TEAPTPRLVSTATSRPRALPRPATTQEPDIPERSTLPLGTTAPGPTEVAQTPTPETFLTT
IRDEPEVPVSGGPSGDFELPEEETTQPDTANEVVAVGGAAAKASSPPGTLPKGARPGPGL
LDNAIDSGSSAAQLPQKSILERKEVLVAVIVGGVVGALFAAFLVTLLIYRMKKKDEGSYT
LEEPKQASVTYQKPDKQEEFYA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggggccgccgcaccgtgccggggccgcccacggggccggcgccggggccggg
gccgcggccgggcccggggcccgcgggctgctcctgccaccgctgctgctgctgctgctg
gcggggcgcgccgcgggggcccagcgctggcgcagtgagaacttcgagagacccgtggac
ctggagggctctggggatgatgactcctttcccgatgatgaactggatgacctctactcg
gggtcgggctcgggctacttcgagcaggagtcgggcattgagacagccatgcgcttcagc
ccagatgtagccctggcggtgtccaccacacctgcggtgctgcccaccacgaacatccag
cctgtgggcacaccatttgaagagctcccctctgagcgccccaccctggagccagccacc
agccccctggtggtgacagaagtcccggaagagcccagccagagagccaccaccgtctcc
actaccatggctaccactgctgccacaagcacaggggacccgactgtggccacagtgcct
gccacagtggccaccgccacccccagcacccctgcagcacccccttttacggccaccact
gctgttataaggaccactggcgtacggaggcttctgcctctcccactgaccacagtggct
acggcacgggccactacccccgaggcgccctccccgcccaccacggcggctgtcttggac
accgaggccccaacacccaggctggtcagcacagctacctcccggccaagagcccttccc
aggccggccaccacccaggagcctgacatccctgagaggagcaccctgcccctggggacc
actgcccctggacccacagaggtggctcagaccccaactccagagaccttcctgaccaca
atccgggatgagccagaggttccggtgagtggggggcccagtggagacttcgagctgcca
gaagaagagaccacacaaccagacacagccaatgaggtggtagctgtgggaggggctgcg
gccaaggcatcatctccacctgggacactgcccaagggtgcccgcccgggccctggcctc
ctggacaatgccatcgactcgggcagctcagctgctcagctgcctcagaagagtatcctg
gagcggaaggaggtgctcgtagctgtgattgtgggcggggtggtgggcgccctctttgct
gccttcttggtcacactgctcatctatcgtatgaagaaaaaggatgagggcagctacacg
ctggaggaacccaagcaggcgagcgtcacataccagaagcctgacaagcaggaggagttc
tatgcctag

DBGET integrated database retrieval system