KEGG   Homo sapiens (human): 9673Help
Entry
9673              CDS       T01001                                 

Gene name
SLC25A44
Definition
(RefSeq) solute carrier family 25 member 44
  KO
K15121  solute carrier family 25, member 44
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9673 (SLC25A44)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   9673 (SLC25A44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 9673
NCBI-ProteinID: NP_055470
OMIM: 610824
HGNC: 29036
Ensembl: ENSG00000160785
Vega: OTTHUMG00000014816
Pharos: Q96H78(Tdark)
UniProt: Q96H78
Position
1q22
AA seq 314 aa AA seqDB search
MEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDA
FIKILRADGITGLYRGFLVNTFTLISGQCYVTTYELTRKFVADYSQSNTVKSLVAGGSAS
LVAQSITVPIDVVSQHLMMQRKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILQADGLR
GFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSYLCPKECPHIVFQAVSGPLAAATASILT
NPMDVIRTRVQVEGKNSIILTFRQLMAEEGPWGLMKGLSARIISATPSTIVIVVGYESLK
KLSLRPELVDSRHW
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggaggacaaacgcaacatccagatcatcgagtgggaacacctggacaagaagaagttc
tacgtgtttggtgtggcaatgacaatgatgatccgtgtcagtgtctacccattcaccctc
atccgcacccggttgcaagttcagaaggggaagagcctctaccatgggaccttcgatgcc
ttcatcaagatcctgcgagcagatggtatcactggcctctaccgagggttcctggtcaat
accttcaccctcatctctggccagtgttatgtcaccacttatgagctcacccggaagttt
gtagctgactacagccagagtaacacagtcaaatcactggtggctggtggctcagcctcc
cttgtggcccagagcatcacagtgcccattgatgtagtctcccagcacctgatgatgcaa
cgcaagggtgagaaaatgggccgctttcaggtgcgggggaacccagagggacaaggggta
gttgcctttggccaaaccaaggacatcatcaggcagatcctgcaggctgatggacttcgc
ggcttctatcgaggctatgtggcttcactgcttacctatatcccaaacagtgctgtctgg
tggcccttctatcacttctatgcagagcagctctcctacctgtgtcctaaggagtgccct
cacattgtctttcaagctgtctcggggcccctggctgcagccactgcctccatcctcacc
aatcccatggatgtcatacgaacccgtgtgcaggttgagggcaagaactccatcatcctg
accttcagacagctgatggcagaagaagggccttggggcctcatgaagggcctctcggcc
agaatcatctcagccacaccttccaccattgtcattgtggtgggctatgagagcctcaag
aaactcagcctccgacctgagctggtggactcgagacactggtaa

DBGET integrated database retrieval system