KEGG   Homo sapiens (human): 9674Help
Entry
9674              CDS       T01001                                 

Definition
(RefSeq) KIAA0040
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: FAM176 ETRAMP AgrB UPF0542 Adeno_PV Comm FHIPEP Adeno_E3_CR2 Ac76 EphA2_TM
Motif
Other DBs
NCBI-GeneID: 9674
NCBI-ProteinID: NP_001156365
OMIM: 616696
HGNC: 28950
Ensembl: ENSG00000235750
Vega: OTTHUMG00000034880
UniProt: Q15053
Position
1q25.1
AA seq 99 aa AA seqDB search
MERISAFFSSIWDTILTKHQEGIYNTICLGVLLGLPLLVIITLLFICCHCCWSPPGKRGQ
QPEKNKKKKKKKKKKDEEDLWISAQPKLLQMEKRPSLPV
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggagagaatcagtgccttcttcagctctatctgggacaccatcttgaccaaacaccaa
gaaggcatctacaacaccatctgcctgggagtcctcctgggcctgccactcttggtgatc
atcacactcctcttcatctgttgccattgctgctggagcccaccaggcaagaggggccag
cagccagagaagaacaagaagaagaagaagaagaagaagaagaaggatgaagaagacctc
tggatctctgctcaacccaagcttctccagatggagaagagaccatcactgcctgtttag

DBGET integrated database retrieval system