KEGG   Homo sapiens (human): 96764Help
Entry
96764             CDS       T01001                                 

Gene name
TGS1, NCOA6IP, PIMT, PIPMT
Definition
(RefSeq) trimethylguanosine synthase 1
  KO
K14292  trimethylguanosine synthase [EC:2.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    96764 (TGS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     96764 (TGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_15 Methyltransf_25 Methyltransf_31 Met_10 UPF0020 Methyltransf_11 Cons_hypoth95 PrmA
Motif
Other DBs
NCBI-GeneID: 96764
NCBI-ProteinID: NP_079107
OMIM: 606461
HGNC: 17843
Ensembl: ENSG00000137574
Vega: OTTHUMG00000164294
Pharos: Q96RS0(Tbio)
UniProt: Q96RS0
Structure
PDB: 

Position
8q12.1
AA seq 853 aa AA seqDB search
MCCEKWSRVAEMFLFIEEREDCKILCLCSRAFVEDRKLYNLGLKGYYIRDSGNNSGDQAT
EEEEGGYSCGTAESHDSKGIGLDESELDSEAELMRSMGLPLQFGRITAHKDFEVSMNTRN
KVKIKKKKHQKKYLDEIVQESWRKEYEEDDILASDDPSSIEQYENTRTYELQSKKDTETE
NPPVENTLSPKLEITEKWEKYWNEYGGGLLWQSWQEKHPGQALSSEPWNFPDTKEEWEQH
YSQLYWYYLEQFQYWEAQGWTFDASQSCDTDTYTSKTEADDKNDEKCMKVDLVSFPSSPI
MVDNDSSGTSDKDHSEILDGISNIKLNSEEVTQSQLDSCTSHDGHQQLSEVSSKRECPAS
GQSEPRNGGTNEESNSSGNTNTDPPAEDSQKSSGANTSKDRPHASGTDGDESEEDPPEHK
PSKLKRSHELDIDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSK
YLDMRRQIKMKNKHIFFTKESEKPFFKKSKILSKVEKFLTWVNKPMDEEASQESSSHDNV
HDASTSSDSEEQDMSVKKGDDLLETNNPEPEKCQSVSSAGELETENYERDSLLATVPDEQ
DCVTQEVPDSRQAETEAEVKKKKNKKKNKKVNGLPPEIAAVPELAKYWAQRYRLFSRFDD
GIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDI
DPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGGPDYATAETFDIR
TMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITA
YFGDLIRRPASET
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgtgctgcgagaagtggagccgcgtggcggaaatgtttctcttcattgaggagcgggag
gattgtaagatactgtgcctttgctccagggcatttgtggaggatcgaaaattgtacaat
ttgggattaaaaggctattacatcagagacagtggcaacaattcaggagaccaggcgaca
gaagaagaggaaggtggttattcctgtggtactgcagaatcacatgacagcaaaggcata
ggcctggatgaaagtgaacttgattctgaggctgaactcatgagaagtatgggattgcca
cttcaatttggtaggataactgcacataaggattttgaggtatctatgaatactagaaat
aaagttaaaataaaaaagaaaaaacatcaaaagaaatacttagatgaaattgtgcaagaa
tcttggagaaaagaatatgaagaagacgacattttggcttcagatgatccatcttcaatt
gaacagtatgagaacaccagaacatatgaacttcaaagcaaaaaagatactgagacagaa
aatcctccagttgaaaacacattatctccaaagctagaaattacagagaaatgggaaaag
tattggaatgaatatggaggaggactattgtggcaaagttggcaagaaaaacatccgggt
caagcactatcttctgaaccttggaactttcctgatacaaaggaagaatgggagcaacat
tatagtcaactttattggtattatttggaacaatttcagtattgggaagctcagggttgg
acttttgatgcctcgcaaagctgtgatacagatacttacacatctaaaacagaagctgat
gacaagaacgatgaaaaatgcatgaaagttgacttagtatcttttccatcttcacctatt
atggttgataatgatagctctggtacaagtgataaggatcatagtgaaatacttgatgga
attagtaacataaaactgaattcagaggaagtaacacagagccaattagattcctgtaca
agtcatgatggtcatcaacagctaagtgaagttagtagcaaaagagagtgccctgcttcc
ggccaaagtgaaccacgtaatggaggaaccaatgaggaaagcaactcatcggggaataca
aacacagacccaccagctgaggattcacagaagtcttcaggagcaaacacaagcaaagac
agaccacatgccagtggtactgatggagatgaaagtgaggaagacccacctgagcataag
ccaagcaaactgaagaggagccatgaactggacattgatgaaaacccagcttcagacttt
gatgacagtggttcccttctaggattcaagtatggctcaggacaaaaatatggtggaatc
ccaaatttcagtcatcggcaggtcaggtatttagagaagaatgtgaagcttaagtctaag
tacctagacatgcgcagacaaataaagatgaaaaacaaacacatcttctttaccaaagag
tcagaaaaaccatttttcaagaaaagcaaaattctgagtaaggtagaaaaattcctcaca
tgggttaataaaccaatggatgaagaagcatcacaggaatcatcttctcatgacaatgtg
cacgacgcttccacaagtagtgattcagaggaacaagacatgtctgttaaaaaaggtgat
gacctactggagactaataatccagaacctgaaaagtgtcagagcgtatcttcagctggt
gaacttgaaacagaaaactatgaaagagacagcttgctagcaactgttccagatgagcag
gattgtgttactcaagaagtgccagactcccgccaggcagaaactgaagctgaagtgaaa
aagaagaagaacaagaagaagaacaaaaaggtgaatggtctgcctcctgaaatagctgct
gttcctgagctggcaaaatactgggcccagaggtacaggctcttctcccgttttgatgat
gggattaagttggacagagagggctggttttcagttacacccgagaagattgctgaacac
attgctggccgtgttagtcagtccttcaagtgtgacgttgtagtagacgcattctgtgga
gttggaggaaataccattcagtttgccttaacaggaatgagagtgattgccattgatatc
gatcctgttaagattgcccttgctcgcaataatgcagaagtttatgggatagcagataag
atagagttcatctgtggagatttcttgctgctggcttcttttttaaaggctgatgttgtg
ttcctcagcccaccttggggagggccagactatgccactgcagagacctttgacattaga
acaatgatgtctcctgatggctttgaaattttcagactttctaagaagatcactaataat
attgtttattttcttccaagaaatgctgatattgaccaggtggcatccttagctgggcct
ggagggcaagtggaaatagaacagaacttccttaacaacaaattgaagacaatcactgca
tattttggtgacctaattcgaagaccagcctctgaaacctaa

DBGET integrated database retrieval system