KEGG   Homo sapiens (human): 9677
Entry
9677              CDS       T01001                                 

Gene name
PPIP5K1, HISPPD2A, IP6K, IPS1, VIP1, hsVIP1
Definition
(RefSeq) diphosphoinositol pentakisphosphate kinase 1
  KO
K13024  inositol-hexakisphosphate/diphosphoinositol-pentakisphosphate 1-kinase [EC:2.7.4.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    9677 (PPIP5K1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.24  diphosphoinositol-pentakisphosphate kinase
     9677 (PPIP5K1)
SSDB
Motif
Pfam: His_Phos_2 PPIP5K2_N RimK
Other DBs
NCBI-GeneID: 9677
NCBI-ProteinID: NP_001124330
OMIM: 610979
HGNC: 29023
Ensembl: ENSG00000168781
Vega: OTTHUMG00000059758
Pharos: Q6PFW1(Tbio)
UniProt: Q6PFW1
Position
15q15.3
AA seq 1433 aa
MWSLTASEGESTTAHFFLGAGDEGLGTRGIGMRPEESDSELLEDEEDEVPPEPQIIVGIC
AMTKKSKSKPMTQILERLCRFDYLTVVILGEDVILNEPVENWPSCHCLISFHSKGFPLDK
AVAYSKLRNPFLINDLAMQYYIQDRREVYRILQEEGIDLPRYAVLNRDPARPEECNLIEG
EDQVEVNGAVFPKPFVEKPVSAEDHNVYIYYPSSAGGGSQRLFRKIGSRSSVYSPESSVR
KTGSYIYEEFMPTDGTDVKVYTVGPDYAHAEARKSPALDGKVERDSEGKEIRYPVMLTAM
EKLVARKVCVAFKQTVCGFDLLRANGHSFVCDVNGFSFVKNSMKYYDDCAKILGNTIMRE
LAPQFQIPWSIPTEAEDIPIVPTTSGTMMELRCVIAIIRHGDRTPKQKMKMEVKHPRFFA
LFEKHGGYKTGKLKLKRPEQLQEVLDITRLLLAELEKEPGGEIEEKTGKLEQLKSVLEMY
GHFSGINRKVQLTYYPHGVKASNEGQDPQRETLAPSLLLVLKWGGELTPAGRVQAEELGR
AFRCMYPGGQGDYAGFPGCGLLRLHSTFRHDLKIYASDEGRVQMTAAAFAKGLLALEGEL
TPILVQMVKSANMNGLLDSDGDSLSSCQHRVKARLHHILQQDAPFGPEDYDQLAPTRSTS
LLNSMTIIQNPVKVCDQVFALIENLTHQIRERMQDPRSVDLQLYHSETLELMLQRWSKLE
RDFRQKSGRYDISKIPDIYDCVKYDVQHNGSLGLQGTAELLRLSKALADVVIPQEYGISR
EEKLEIAVGFCLPLLRKILLDLQRTHEDESVNKLHPLCYLRYSRGVLSPGRHVRTRLYFT
SESHVHSLLSVFRYGGLLDETQDAQWQRALDYLSAISELNYMTQIVIMLYEDNTQDPLSE
ERFHVELHFSPGVKGVEEEGSAPAGCGFRPASSENEEMKTNQGSMENLCPGKASDEPDRA
LQTSPQPPEGPGLPRRSPLIRNRKAGSMEVLSETSSSRPGGYRLFSSSRPPTEMKQSGLG
SQCTGLFSTTVLGGSSSAPNLQDYARSHGKKLPPASLKHRDELLFVPAVKRFSVSFAKHP
TNGFEGCSMVPTIYPLETLHNALSLRQVSEFLSRVCQRHTDAQAQASAALFDSMHSSQAS
DNPFSPPRTLHSPPLQLQQRSEKPPWYSSGPSSTVSSAGPSSPTTVDGNSQFGFSDQPSL
NSHVAEEHQGLGLLQETPGSGAQELSIEGEQELFEPNQSPQVPPMETSQPYEEVSQPCQE
VPDISQPCQDISEALSQPCQKVPDISQQCQENHDNGNHTCQEVPHISQPCQKSSQLCQKV
SEEVCQLCLENSEEVSQPCQGVSVEVGKLVHKFHVGVGSLVQETLVEVGSPAEEIPEEVI
QPYQEFSVEVGRLAQETSAINLLSQGIPEIDKPSQEFPEEIDLQAQEVPEEIN
NT seq 4302 nt   +upstreamnt  +downstreamnt
atgtggtcattgacggccagtgagggcgagagtaccacggcccacttcttccttggagct
ggagatgaggggctgggcacccgtggaataggcatgaggccagaagagagtgacagcgag
ctccttgaggatgaggaggatgaagtgcctcctgaacctcagatcattgttggcatctgt
gccatgaccaagaaatccaagtccaagccaatgactcaaatcctagagcgactctgcaga
tttgactacctgactgttgtcattctgggagaagatgtaatccttaatgaacctgtggaa
aactggccatcctgccactgcctcatctctttccactccaaaggctttcctctggacaaa
gctgttgcttactccaagcttcgaaacccctttcttatcaatgatctggccatgcagtat
tacatccaagataggagggaggtgtaccggatcctgcaggaagagggtattgatctgcct
cgatatgctgtgctcaaccgtgatcctgcccggcctgaggaatgcaacctgatagaaggt
gaagaccaagtagaggtcaatggagctgtctttcccaagccctttgtggagaagccagtg
agtgcagaagaccacaatgtttacatctactaccccagctcagctggaggaggaagccag
cgtctctttcgtaagattggcagccgaagcagtgtttactctcctgagagcagcgtccga
aagacggggtcgtacatctatgaggagtttatgccaacagatggcacagatgtcaaggtg
tatacagtggggccagattatgcccatgctgaagctagaaaatctccagctttggatggg
aaggttgaacgagacagtgaggggaaagagattcgatatccagtcatgctgactgccatg
gaaaagctggtggccaggaaagtctgcgtagctttcaagcaaacagtttgtggatttgac
cttcttcgtgccaatggtcattcctttgtgtgtgatgtcaatggctttagttttgtcaag
aactcgatgaaatactacgatgactgtgccaagattctggggaacaccataatgcgggag
cttgccccacagttccagattccatggtccatccccacggaggctgaggacattcccatt
gttcccaccacatctggcactatgatggaacttcgttgtgtcattgcaattattcgtcat
ggggatcgtactcccaagcagaagatgaagatggaagtgaaacacccaaggttttttgct
ctgtttgaaaaacatggtggctacaagacagggaaattaaaactcaagcgacctgagcag
ctccaggaggtgctggatatcacaaggctgttgttggctgaactggagaaagaaccaggt
ggtgagatcgaggagaagactggaaaactagagcagctgaagtctgtactggagatgtat
ggtcacttctcaggtataaaccggaaggtacaattgacttactaccctcatggagtaaaa
gcttctaatgaggggcaagatccacagagggaaactctggccccatctctgttgctggta
ctgaagtggggtggagaactgactcctgctggccgtgttcaggctgaggagctggggcga
gcttttcgctgcatgtaccctggaggacagggtgactatgctggcttccctggttgtggg
ctgcttcgtctccatagcactttccgccacgatctcaagatctatgcctctgatgagggt
cgtgttcagatgactgctgctgccttcgccaagggccttctggctctagaaggggagctg
acacccattttggtgcaaatggtgaagagtgccaacatgaatgggctactggacagcgat
ggggattccttgagcagctgccagcaccgggtgaaggctcggctgcaccatattctacag
caggatgcgccctttggccctgaggactacgatcagctggctcccaccagaagtacttcc
ctgctcaactccatgactatcatccagaatcctgtgaaggtctgtgatcaggtatttgcc
ctgatcgaaaacctcacccaccagatccgggaacgaatgcaggaccccaggtctgtagac
ctgcagctctaccacagtgagacactagagctaatgctacagcgttggagcaagctggag
cgtgactttcgacagaagagtgggcgctatgatatcagtaagatccctgacatctatgac
tgtgtcaagtatgatgtgcagcacaatgggagtctgggacttcaaggcacagcagagttg
ctccgtctctctaaggcactggctgatgtggtcattccccaggagtacgggatcagtcgg
gaggagaaactggaaattgctgtgggcttctgtcttccactgttgcggaagatactactt
gacctgcagagaacccacgaggatgagtctgtcaacaagctgcatcccctctgttatctc
aggtactcccgaggcgtgctctccccaggtcgccacgttcgaacgcgtctctatttcacc
agtgagagccatgtccactccctgctcagtgtcttccgttatggaggacttcttgatgag
acccaggatgcacaatggcagcgagctttggattatcttagtgccatctcagagcttaac
tacatgacccagattgtcatcatgctttatgaggacaacacacaggatcccttatcagag
gaacggttccatgtggagctacacttcagccccggagtgaaaggtgttgaggaagaaggc
agtgccccggctggctgtggattccgtccagcctcttctgagaatgaggagatgaaaacc
aaccaaggcagtatggagaacctgtgtccaggaaaggcatcagatgaaccagaccgggca
ttgcagacttcaccccagcctcctgagggccctggccttccgaggagatcacccctcatt
cgtaaccgaaaagctggttccatggaggtactttctgagacttcatcctcgaggcctggt
ggctaccggctcttttcatcttcacggccacccacagaaatgaagcagagtggcctaggc
tcacagtgcacagggctgttcagcaccacagtgctgggtggctcctccagtgccccgaat
cttcaggactacgcccgcagccatggcaaaaagctaccacctgccagtctgaagcaccga
gatgagctcttgtttgtcccggccgtaaaacgattttctgtgtcgtttgcaaagcatccg
actaacgggtttgaagggtgttccatggtgcctaccatctaccctctggaaacactgcat
aatgccctttccctacgtcaagtgagtgaattcttgagtagagtctgccagcgccacact
gatgcccaggcacaggcatctgcagccctctttgattccatgcacagcagccaggcctca
gataacccattttctccaccacgtactcttcattcacctcccctgcaactccagcagcgc
tctgagaagcccccttggtacagcagtggcccttctagcactgtgtccagtgctggtcct
tcttcccctactacagtagatggtaactcccaatttggcttcagtgatcaaccctcccta
aattcacacgtggctgaagaacatcaaggccttgggctgctccaggagacccctgggagt
ggagcacaagagctctccatagaaggggagcaagagctttttgaaccaaatcagtcccca
caggtgccacctatggaaaccagccagccatacgaggaggtcagccagccatgtcaggag
gtccctgacatcagccagccatgccaggacatttctgaggcgctcagccagccatgtcag
aaggtccctgacatcagccagcaatgccaggagaaccatgacaatggtaaccacacatgc
caggaggtccctcacatcagccagccatgccagaagtccagccaactgtgccagaaagtc
tctgaggaagtttgccagctatgtctggagaactccgaggaggtcagccagccatgccag
ggggtctctgtggaggttggcaagctggtccataagttccatgtaggggttggtagcttg
gtccaggaaacccttgtagaagttggcagcccagctgaagagatccctgaggaggtcatc
cagccataccaggagttctctgtggaggttggcaggctggcccaggagacttctgcgatc
aatctgttatctcagggcatccctgagattgataaaccatcccaagagttccctgaggag
attgatctgcaggcccaggaggtccctgaggagataaattag

DBGET integrated database retrieval system