KEGG   Homo sapiens (human): 968Help
Entry
968               CDS       T01001                                 

Gene name
CD68, GP110, LAMP4, SCARD1
Definition
(RefSeq) CD68 molecule
  KO
K06501  CD68 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    968 (CD68)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    968 (CD68)
CD molecules [BR:hsa04090]
 Proteins
  968 (CD68)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lamp ATP-synt_S1
Motif
Other DBs
NCBI-GeneID: 968
NCBI-ProteinID: NP_001242
OMIM: 153634
HGNC: 1693
Ensembl: ENSG00000129226
Vega: OTTHUMG00000108146
Pharos: P34810(Tbio)
UniProt: P34810
Position
17p13.1
AA seq 354 aa AA seqDB search
MRLAVLFSGALLGLLAAQGTGNDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTT
THRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNAT
VHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRV
MYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSY
MAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAA
QLPHTGVFGQSFSCPSDRSILLPLIIGLILLGLLALVLIAFCIIRRRPSAYQAL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggctgtgcttttctcgggggccctgctggggctactggcagcccaggggaca
gggaatgactgtcctcacaaaaaatcagctactttgctgccatccttcacggtgacaccc
acggttacagagagcactggaacaaccagccacaggactaccaagagccacaaaaccacc
actcacaggacaaccaccacaggcaccaccagccacggacccacgactgccactcacaac
cccaccaccaccagccatggaaacgtcacagttcatccaacaagcaatagcactgccacc
agccagggaccctcaactgccactcacagtcctgccaccactagtcatggaaatgccacg
gttcatccaacaagcaacagcactgccaccagcccaggattcaccagttctgcccaccca
gaaccacctccaccctctccgagtcctagcccaacctccaaggagaccattggagactac
acgtggaccaatggttcccagccctgtgtccacctccaagcccagattcagattcgagtc
atgtacacaacccagggtggaggagaggcctggggcatctctgtactgaaccccaacaaa
accaaggtccagggaagctgtgagggtgcccatccccacctgcttctctcattcccctat
ggacacctcagctttggattcatgcaggacctccagcagaaggttgtctacctgagctac
atggcggtggagtacaatgtgtccttcccccacgcagcacagtggacattctcggctcag
aatgcatcccttcgagatctccaagcacccctggggcagagcttcagttgcagcaactcg
agcatcattctttcaccagctgtccacctcgacctgctctccctgaggctccaggctgct
cagctgccccacacaggggtctttgggcaaagtttctcctgccccagtgaccggtccatc
ttgctgcctctcatcatcggcctgatccttcttggcctcctcgccctggtgcttattgct
ttctgcatcatccggagacgcccatccgcctaccaggccctctga

DBGET integrated database retrieval system