KEGG   Homo sapiens (human): 9687Help
Entry
9687              CDS       T01001                                 

Gene name
GREB1
Definition
(RefSeq) growth regulating estrogen receptor binding 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: GREB1
Motif
Other DBs
NCBI-GeneID: 9687
NCBI-ProteinID: NP_055483
OMIM: 611736
HGNC: 24885
Ensembl: ENSG00000196208
Vega: OTTHUMG00000141276
Pharos: Q4ZG55(Tbio)
UniProt: Q4ZG55
Position
2p25.1
AA seq 1949 aa AA seqDB search
MGNSYAGQLKTTRFEEVLHNSIEASLRSNNLVPRPIFSQLYLEAEQQLAALEGGSRVDNE
EEEEEGEGGLETNGPPNPFQLHPLPEGCCTTDGFCQAGKDLRLVSISNEPMDVPAGFLLV
GVKSPSLPDHLLVCAVDKRFLPDDNGHNALLGFSGNCVGCGKKGFCYFTEFSNHINLKLT
TQPKKQKHLKYYLVRNAQGTLTKGPLICWKGSEFRSRQIPASTCSSSLFPALESTAAFPS
EPVPGTNPSILMGAQQAGPASDHPSLNAAMGPAVFNGKDSPKCQQLAKNNLLALPRPSAL
GILSNSGPPKKRHKGWSPESPSAPDGGCPQGGGNRAKYESAGMSCVPQVGLVGPASVTFP
VVASGEPVSVPDNLLKICKAKPVIFKGHGNFPYLCGNLNDVVVSPLLYTCYQNSQSVSRA
YEQYGASAIQPISEEMQLLLTVYYLVQLAADQVPLMEDLEQIFLRSWRESHLTEIRQYQQ
APPQPFPPAPSAAAPVTSAQLPWLASLAASSCNDSVHVIECAYSLAEGLSEMFRLLVEGK
LAKTNYVVIICACRSAAIDSCIAVTGKYQARILSESLLTPAEYQKEVNYELVTGKVDSLG
AFFSTLCPEGDIDILLDKFHQENQGHISSSLAASSVTKAASLDVSGTPVCTSYNLEPHSI
RPFQLAVAQKLLSHVCSIADSSTQNLDLGSFEKVDFLICIPPSEVTYQQTLLHVWHSGVL
LELGLKKEHMTKQRVEQYVLKLDTEAQTKFKAFLQNSFQNPHTLFVLIHDHAHWDLVSST
VHNLYSQSDPSVGLVDRLLNCREVKEAPNIVTLHVTSFPYALQTQHTLISPYNEIHWPAS
CSNGVDLYHENKKYFGLSEFIESTLSGHSLPLLRYDSSFEAMVTALGKRFPRLHSAVIRT
FVLVQHYAAALMAVSGLPQMKNYTSVETLEITQNLLNSPKQCPCGHGLMVLLRVPCSPLA
VVAYERLAHVRARLALEEHFEIILGSPSSGVTVGKHFVKQLRMWQKIEDVEWRPQTYLEL
EGLPCILIFSGMDPHGESLPRSLRYCDLRLINSSCLVRTALEQELGLAAYFVSNEVPLEK
GARNEALESDAEKLSSTDNEDEELGTEGSTSEKRSPMKRERSRSHDSASSSLSSKASGSA
LGGESSAQPTALPQGEHARSPQPRGPAEEGRAPGEKQRPRASQGPPSAISRHSPGPTPQP
DCSLRTGQRSVQVSVTSSCSQLSSSSGSSSSSVAPAAGTWVLQASQCSLTKACRQPPIVF
LPKLVYDMVVSTDSSGLPKAASLLPSPSVMWASSFRPLLSKTMTSTEQSLYYRQWTVPRP
SHMDYGNRAEGRVDGFHPRRLLLSGPPQIGKTGAYLQFLSVLSRMLVRLTEVDVYDEEEI
NINLREESDWHYLQLSDPWPDLELFKKLPFDYIIHDPKYEDASLICSHYQGIKSEDRGMS
RKPEDLYVRRQTARMRLSKYAAYNTYHHCEQCHQYMGFHPRYQLYESTLHAFAFSYSMLG
EEIQLHFIIPKSKEHHFVFSQPGGQLESMRLPLVTDKSHEYIKSPTFTPTTGRHEHGLFN
LYHAMDGASHLHVLVVKEYEMAIYKKYWPNHIMLVLPSIFNSAGVGAAHFLIKELSYHNL
ELERNRQEELGIKPQDIWPFIVISDDSCVMWNVVDVNSAGERSREFSWSERNVSLKHIMQ
HIEAAPDIMHYALLGLRKWSSKTRASEVQEPFSRCHVHNFIILNVDLTQNVQYNQNRFLC
DDVDFNLRVHSAGLLLCRFNRFSVMKKQIVVGGHRSFHITSKVSDNSAAVVPAQYICAPD
SKHTFLAAPAQLLLEKFLQHHSHLFFPLSLKNHDHPVLSVDCYLNLGSQISVCYVSSRPH
SLNISCSDLLFSGLLLYLCDSFVGASFLKKFHFLKGATLCVICQDRSSLRQTVVRLELED
EWQFRLRDEFQTANAREDRPLFFLTGRHI
NT seq 5850 nt NT seq  +upstreamnt  +downstreamnt
atgggaaattcttacgctggacagctgaagacgacacgctttgaagaggtcttgcacaat
tccatcgaggcatccctgcggtccaacaacctggtgcccaggcccatcttttcccagctg
tacctggaagctgagcagcagcttgccgctctagaaggtggtagccgagtggacaatgag
gaagaggaagaagagggagaaggagggctggaaacaaatggccccccaaaccctttccag
ctgcaccctctgcctgaaggatgctgtaccacagacgggttttgccaggccgggaaggac
ctgcgccttgtctccatttccaacgagcccatggatgtccctgcgggctttctcctcgtg
ggggtcaagtcccccagcctgccggaccatctcctggtgtgcgccgttgacaagaggttc
ttgccagatgacaatggccacaatgctcttcttggtttctctgggaattgtgttggctgt
ggaaagaaaggcttctgttacttcacggaattctccaatcatataaatctgaaactgacc
actcaacccaagaagcagaaacacttgaagtattacctggtccgtaatgcacaagggact
ctaaccaaaggacctttaatctgttggaaaggctcagagtttagaagccggcagatcccc
gccagtacttgttccagttccctcttcccagccctggagagcacggctgccttccccagc
gagcccgttcctgggacgaaccccagcatcctgatgggagctcagcaggcaggaccagct
tctgatcacccctcactaaacgcagcaatgggtccggctgttttcaacggcaaagattcc
ccgaagtgccaacaactggcaaagaataacctgttggccctgccgcgaccatcggcttta
ggtatcttgtcaaactccgggccccccaaaaaacgccacaaagggtggtctccagaatct
ccatcagctccagatggtggctgcccccaaggtggtgggaacagagctaagtatgagagc
gcaggcatgtcctgcgtgccgcaggttggcttggtgggaccagcttcagtcacctttcca
gtggtggcctctggagaaccagtgtctgttcctgacaacttgctgaaaatatgcaaggcc
aagccagtgatatttaaaggccatgggaacttcccttacctctgtgggaacctgaatgac
gtcgtggtcagccccctcttgtacacgtgctaccagaattcccagtctgtctcacgggca
tacgagcagtacggcgcctctgccatccagcccatctccgaggagatgcagctcctgctt
accgtctactacctggtccagctggccgcggaccaggtgcccttgatggaggacctggag
cagatcttcctgcgctcttggcgcgagtcgcacctgaccgagatccggcagtaccagcag
gcgccgccgcagcccttcccgcccgcgcccagcgccgcggcacccgtgacctccgcgcag
ctgccctggctggccagcctggccgccagctcctgcaacgacagcgtgcacgtcatcgag
tgtgcttactccctggccgagggcctctccgagatgttccggctgttggtcgagggcaag
cttgccaagaccaactacgtggtcatcatctgcgcctgccgcagcgcggccatcgactcc
tgcatcgccgtcaccggaaaataccaagcccggattctttccgagagccttctcactcct
gcggagtaccagaaggaagtcaattacgagctggttacggggaaggtagactcgctgggg
gccttctttagcaccctctgtccagagggtgacattgacattttgctggacaaatttcac
caggaaaatcaaggccatatttcttcctcactcgctgcctcttctgtcactaaagcagca
tccctggatgtcagtgggacaccggtgtgcacaagttacaatctggagccacacagcatc
cggcccttccagctggcagtagcgcagaagctcctctcccatgtgtgttccattgcggat
tccagcacccaaaatctggacctgggatcctttgagaaggtggactttctcatttgcatt
cccccctcagaagtgacctaccagcagactctgctccatgtgtggcattcaggggttttg
ctggagcttggtctgaagaaagagcacatgacgaagcagagggtggaacagtatgttctg
aagctagacacggaggcacagacaaaatttaaggcttttctgcaaaactccttccagaac
ccgcatacactttttgtcctaatccatgaccatgcgcactgggatcttgtgagtagcact
gttcataacctctattctcaaagtgacccgtcggtgggattggtggaccgattgctcaac
tgcagggaggtgaaggaggcccccaacattgtgacacttcacgtgacctccttcccgtat
gcactgcagacacagcacaccctcatcagcccctacaacgagatccactggcctgcctcc
tgcagtaatggagtggacttatatcatgaaaataagaagtacttcgggctgtcggagttt
attgaatccaccctttcaggacacagcctccccttgctcagatacgatagctcctttgag
gccatggtcactgcattaggaaaaaggttcccccgcctgcacagcgcggtgatcaggacc
tttgttctcgtgcagcactacgcggccgccctgatggccgtaagcggcctcccgcagatg
aagaactacacgtcggtggagacgctggagatcacgcagaacctcctcaactccccgaag
cagtgcccctgcggccacgggctcatggtcctgctgcgggtgccctgttcgcccctggcg
gtggtggcctatgagcggctggcccacgtgcgggcccggctggcgctggaggagcacttt
gagatcatcctgggcagtcccagctcaggcgtcaccgtggggaagcacttcgtaaagcag
ctcaggatgtggcagaaaattgaggatgtggagtggagaccccagacttacttggagctg
gagggtctgccttgcatcctgatcttcagtgggatggacccgcatggggagtccttgccg
aggtctttgaggtactgtgacctgcgattgataaactcctcctgcttggtgagaacagcc
ttggagcaggagctgggcctggctgcctactttgtgagcaacgaggttcccttggagaag
ggggctaggaacgaggccttggagagtgatgctgagaagctgagcagcacagacaacgag
gatgaggagctggggacagaaggctctacctcggagaagagaagccccatgaaaagggag
aggtcccgctcccacgactcagcatcctcatccctctcctccaaggcttccggttcagcg
ctcggtggcgagtcctcggctcagcccacagcactcccccagggagagcatgccaggtcg
ccccagccccgtggccccgcagaggagggcagagcccctggtgagaaacagaggccccgg
gcaagtcaggggccaccctcggccatcagcaggcacagtcccgggccgacgccccagccc
gactgtagcctcaggaccggccagaggagcgtccaggtgtcggtcacctcgtcgtgctcc
cagctgtcctcctcctcgggctcatcctcctcatccgtggcgcccgctgccggcacgtgg
gtcctgcaggcctcccagtgctccttgaccaaggcctgccgccagccacccattgtcttc
ttgcccaagctcgtgtacgacatggttgtgtccactgacagcagtggcctgcccaaggcc
gcctccctcctgccctccccctcggtcatgtgggccagctctttccgccccctgctcagc
aagaccatgacatccaccgagcagtccctctactaccggcagtggacggtgccccggccc
agccacatggactacggcaaccgggccgagggccgcgtggacggcttccacccccgcagg
ctgctgctcagcggcccccctcagatcgggaagacaggtgcctacctgcagttcctcagt
gtcctgtccaggatgcttgttcggctcacagaagtggatgtctatgacgaggaggagatc
aatatcaacctcagagaagaatctgactggcattatctccagcttagcgacccctggcca
gacctggagctgttcaagaagttgccctttgactacatcattcacgacccgaagtatgaa
gatgccagcctgatttgttcgcactatcagggtataaagagtgaagacagagggatgtcc
cggaagccggaggacctttatgtgcggcgtcagacggcacggatgagactgtccaagtac
gcagcgtacaacacttaccaccactgtgagcagtgccaccagtacatgggcttccacccc
cgctaccagctgtatgagtccaccctgcacgcctttgccttctcttactccatgctagga
gaggagatccagctgcacttcatcatccccaagtccaaggagcaccactttgtcttcagc
caacctggaggccagctggagagcatgcgactacccctcgtgacagacaagagccatgaa
tatataaaaagtccgacattcactccaaccaccggccgtcacgaacatgggctctttaat
ctgtaccacgcaatggacggtgccagccatttgcacgtgctggttgtcaaggaatacgag
atggcaatttataagaaatattggcccaaccacatcatgctggtgctccccagtatcttc
aacagtgctggagttggtgctgctcatttcctcatcaaggagctgtcctaccataacctg
gagctcgagcggaaccggcaggaggagctgggaatcaagccgcaggacatctggcctttc
attgtgatctctgatgactcctgcgtgatgtggaacgtggtggatgtcaactctgctggg
gagagaagcagggagttctcctggtcggaaaggaacgtgtctttgaagcacatcatgcag
cacatcgaggcggcccccgacatcatgcactacgccctgctgggcctgcggaagtggtcc
agcaagacccgggccagcgaggtgcaagagcccttctcccgctgccacgtgcacaacttc
atcatcctgaacgtggacctgacccagaacgtgcagtacaaccagaaccggttcctgtgt
gacgatgtagacttcaacctgcgggtgcacagcgccggcctcctgctctgccggttcaac
cgcttcagcgtgatgaagaagcagatcgtggtgggcggccacaggtccttccacatcaca
tccaaggtgtctgataactctgccgcggtcgtgccggcccagtacatctgtgccccggac
agcaagcacacgttcctcgcagcgcccgcccagctcctgctggagaagttcctgcagcac
cacagccacctcttcttcccgctgtccctgaagaaccatgaccacccagtgctgtctgtc
gactgttacctgaacctgggatctcagatttctgtttgctatgtgagctccaggccccac
tctttaaacatcagctgctcggacttgctgttcagtgggctgctgctgtacctctgtgac
tcttttgtgggagctagctttttgaaaaagtttcattttctgaaaggtgcgacgttgtgt
gtcatctgtcaggaccggagctcactgcgccagacggtcgtccgcctggagctcgaggac
gagtggcagttccggctgcgcgatgagttccagaccgccaatgccagggaagaccggccg
ctcttttttctgacgggacgacacatctga

DBGET integrated database retrieval system