KEGG   Homo sapiens (human): 9693Help
Entry
9693              CDS       T01001                                 

Gene name
RAPGEF2, CNrasGEF, NRAPGEP, PDZ-GEF1, PDZGEF1, RA-GEF, RA-GEF-1, RAGEF, Rap-GEP, nRap_GEP
Definition
(RefSeq) Rap guanine nucleotide exchange factor 2
  KO
K08018  Rap guanine nucleotide exchange factor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04530  Tight junction
Disease
H02213  Familial adult myoclonic epilepsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    9693 (RAPGEF2)
   04010 MAPK signaling pathway
    9693 (RAPGEF2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    9693 (RAPGEF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RA PDZ PDZ_6 PDZ_2 cNMP_binding
Motif
Other DBs
NCBI-GeneID: 9693
NCBI-ProteinID: NP_055062
OMIM: 609530
HGNC: 16854
Ensembl: ENSG00000109756
Vega: OTTHUMG00000161451
Pharos: Q9Y4G8(Tbio)
UniProt: Q9Y4G8
Position
4q32.1
AA seq 1499 aa AA seqDB search
MKPLAIPANHGVMGQQEKHSLPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLS
DIYQATESEAGDMDLSGLPETAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTD
DDIEQLLEFMHQLPAFANMTMSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGS
VEVTYPDGKAEILCMGNSFGVSPTMDKEYMKGVMRTKVDDCQFVCIAQQDYCRILNQVEK
NMQKVEEEGEIVMVKEHRELDRTGTRKGHIVIKGTSERLTMHLVEEHSVVDPTFIEDFLL
TYRTFLSSPMEVGKKLLEWFNDPSLRDKVTRVVLLWVNNHFNDFEGDPAMTRFLEEFENN
LEREKMGGHLRLLNIACAAKAKRRLMTLTKPSREAPLPFILLGGSEKGFGIFVDSVDSGS
KATEAGLKRGDQILEVNGQNFENIQLSKAMEILRNNTHLSITVKTNLFVFKELLTRLSEE
KRNGAPHLPKIGDIKKASRYSIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKT
RISILPQKPYNDIGIGQSQDDSIVGLRQTKHIPTALPVSGTLSSSNPDLLQSHHRILDFS
ATPDLPDQVLRVFKADQQSRYIMISKDTTAKEVVIQAIREFAVTATPDQYSLCEVSVTPE
GVIKQRRLPDQLSKLADRIQLSGRYYLKNNMETETLCSDEDAQELLRESQISLLQLSTVE
VATQLSMRNFELFRNIEPTEYIDDLFKLRSKTSCANLKRFEEVINQETFWVASEILRETN
QLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLAPVARLRTTWEKLPNKYEKLFQDL
QDLFDPSRNMAKYRNVLNSQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMI
AKEIRHVGRMASVNMDPALMFRTRKKKWRSLGSLSQGSTNATVLDVAQTGGHKKRVRRSS
FLNAKKLYEDAQMARKVKQYLSNLELEMDEESLQTLSLQCEPATNTLPKNPGDKKPVKSE
TSPVAPRAGSQQKAQSLPQPQQQPPPAHKINQGLQVPAVSLYPSRKKVPVKDLPPFGINS
PQALKKILSLSEEGSLERHKKQAEDTISNASSQLSSPPTSPQSSPRKGYTLAPSGTVDNF
SDSGHSEISSRSSIVSNSSFDSVPVSLHDERRQRHSVSIVETNLGMGRMERRTMIEPDQY
SLGSYAPMSEGRGLYATATVISSPSTEELSQDQGDRASLDAADSGRGSWTSCSSGSHDNI
QTIQHQRSWETLPFGHTHFDYSGDPAGLWASSSHMDQIMFSDHSTKYNRQNQSRESLEQA
QSRASWASSTGYWGEDSEGDTGTIKRRGGKDVSIEAESSSLTSVTTEETKPVPMPAHIAV
ASSTTKGLIARKEGRYREPPPTPPGYIGIPITDFPEGHSHPARKPPDYNVALQRSRMVAR
SSDTAGPSSVQQPHGHPTSSRPVNKPQWHKPNESDPRLAPYQSQGFSTEEDEDEQVSAV
NT seq 4500 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccactagcaatcccagctaaccatggagttatgggccagcaggagaaacactca
cttcctgcagatttcacaaaactgcatcttactgacagtctccacccacaggtgacccac
gtttcttctagccattcaggatgtagtatcactagtgattctgggagcagcagtctttct
gatatctaccaggccacagaaagcgaggctggtgatatggacctgagtgggttgccagaa
acagcagtggattccgaagacgacgacgatgaagaagacattgagagagcatcagatcct
ctgatgagcagggacattgtgagagactgcctagagaaggacccaattgaccggacagat
gatgacattgaacaactcttggaatttatgcaccagttgcctgcttttgccaatatgaca
atgtcagtgaggcgagaactctgtgctgtgatggtgttcgcagtggtggaaagagcaggg
accatagtgttaaatgatggtgaagagctggactcctggtcagtgattctcaatggatct
gtggaagtgacttatccagatggaaaagcagaaatactgtgcatgggaaatagttttggt
gtctctcctaccatggacaaagaatacatgaaaggagtgatgagaacaaaggtggatgac
tgccagtttgtctgcatagcccagcaagattactgccgtattctcaatcaagtagaaaag
aacatgcaaaaagttgaagaggaaggagagattgttatggtgaaagaacaccgagaactt
gatcgaactggaacaagaaagggacacattgtcatcaagggtacctcagaaaggttaaca
atgcatttggtggaagagcattcagtagtagatccaacattcatagaagactttctgttg
acctataggacttttctttctagcccaatggaagtgggcaaaaagttattggagtggttt
aatgacccgagcctcagggataaggttacacgggtagtattattgtgggtaaataatcac
ttcaatgactttgaaggagatcctgcaatgactcgatttttagaagaatttgaaaacaat
ctggaaagagagaaaatgggtggacacctaaggctgttgaatatcgcgtgtgctgctaaa
gcaaaaagaagattgatgacgttaacaaaaccatcccgagaagctcctttgccttttatc
ttacttggaggctctgagaagggatttggaatctttgttgacagtgtagattcaggtagc
aaagcaactgaagcaggcttgaaacggggggatcagatattagaagtaaatggccaaaac
tttgaaaacattcagctgtcaaaagctatggaaattcttagaaataacacacatttatct
atcactgtgaaaaccaatttatttgtatttaaagaacttctaacaagattgtcagaagag
aaaagaaatggtgccccccaccttcctaaaattggtgacattaaaaaggccagtcgctac
tccattccagatcttgctgtagatgtagaacaggtgataggacttgaaaaagtgaacaaa
aaaagtaaagccaacactgtgggaggaaggaacaagctgaaaaagatactcgacaagact
cggatcagtatcttgccacagaaaccatacaatgatattgggattggtcagtctcaagat
gacagcatagtaggattaaggcagacaaagcacatcccaactgcattgcctgtcagtgga
accttatcatccagtaatcctgatttattgcagtcacatcatcgcattttagacttcagt
gctactcctgacttgccagatcaagtgctaagggtttttaaggctgatcagcaaagccgc
tacatcatgatcagtaaggacactacagcaaaggaagtggtcattcaggctatcagggag
tttgctgttactgccaccccggatcaatattcactatgtgaggtctctgtcacacctgag
ggagtaatcaaacaaagaagacttccagatcagctttccaaacttgcagacagaatacaa
ctgagtggaaggtattatctgaaaaacaacatggaaacagaaactctttgttcagatgaa
gatgctcaggagttgttgagagagagtcaaatttccctccttcagctcagcactgtggaa
gttgcaacacagctctctatgcgaaattttgaactctttcgcaacattgaacctactgaa
tatatagatgatttatttaaactcagatcaaaaaccagctgtgccaacctgaagagattt
gaagaagtcattaaccaggaaacattttgggtagcatctgaaattctcagagaaacaaac
cagctgaagaggatgaagatcattaagcatttcatcaagatagcactgcactgtagggaa
tgcaagaattttaactcaatgtttgcaatcatcagtggcctaaacctggcaccagtggca
agactgcgaacgacctgggagaaacttcccaataaatacgaaaaactatttcaagatctc
caagacctgtttgatccttccagaaacatggcaaaatatcgtaatgttctcaatagtcaa
aatctacaacctcccataatccctctattcccagttatcaaaaaggatctcaccttcctt
cacgaaggaaatgactcaaaagtagacgggctggtcaattttgagaagctaaggatgatt
gcaaaagaaattcgtcacgttggccgaatggcttcagtgaacatggaccctgccctcatg
ttcaggactcggaagaagaaatggcggagtttggggtctctcagccagggtagtacaaat
gcaacagtgctagatgttgctcagacaggtggtcataaaaagcgggtacgtcgtagttcc
tttctcaatgccaaaaagctttatgaagatgcccaaatggctcgaaaagtgaagcagtac
ctttccaatttggagctagaaatggacgaggagagtcttcagacattatctctgcagtgt
gagccagcaaccaacacattgcctaagaatcctggtgacaaaaagcctgtcaaatccgag
acctctccagtagctccaagggcagggtcacaacagaaagctcagtccctgccacagccc
cagcagcagccaccaccagcacataaaatcaaccagggactacaggttcccgccgtgtcc
ctttatccttcacggaagaaagtgcccgtaaaggatctcccaccttttggcataaactct
ccacaagctttaaaaaaaattctttctttgtctgaagaaggaagtttggaacgtcacaag
aaacaggctgaagatacaatatcaaatgcatcttcgcagctttcttctcctcctacttct
ccacagagttctccaaggaaaggctatactttggctcccagtggtactgtggataatttt
tcagattctggtcacagtgaaatttcttcacgatccagtattgttagcaattcgtctttt
gactcagtgccagtctcactgcacgatgagaggcgccagaggcattctgtcagcatcgtg
gaaacaaacctagggatgggcaggatggagaggcggaccatgattgaacctgatcagtat
agcttggggtcctatgcaccaatgtccgagggccgaggcttatatgctacagctacagta
atttcttctccaagcacagaggaactttcccaggatcagggggatcgcgcgtcacttgat
gctgctgacagtggccgtgggagctggacgtcatgctcaagtggctcccatgataatata
cagacgatccagcaccagagaagctgggagactcttccattcgggcatactcactttgat
tattcaggggatcctgcaggtttatgggcatcaagcagccatatggaccaaattatgttt
tctgatcatagcacaaagtataacaggcaaaatcaaagtagagagagccttgaacaagcc
cagtcccgagcaagctgggcgtcttccacaggttactggggagaagactcagaaggtgac
acaggcacaataaagcggaggggtggaaaggatgtttccattgaagccgaaagcagtagc
ctaacgtctgtgactacggaagaaaccaagcctgtccccatgcctgcccacatagctgtg
gcatcaagtactacaaaggggctcattgcacgaaaggagggcaggtatcgagagcccccg
cccacccctcccggctacattggaattcccattactgactttccagaagggcactcccat
ccagccaggaaaccgccggactacaacgtggcccttcagagatcgcggatggtcgcacga
tcctccgacacagctgggccttcatccgtacagcagccacatgggcatcccaccagcagc
aggcctgtgaacaaacctcagtggcataaaccgaacgagtctgacccgcgcctcgccccc
tatcagtcccaagggttttccaccgaggaggatgaagatgaacaagtttctgctgtttga

DBGET integrated database retrieval system