KEGG   Homo sapiens (human): 9695Help
Entry
9695              CDS       T01001                                 

Gene name
EDEM1, EDEM
Definition
(RefSeq) ER degradation enhancing alpha-mannosidase like protein 1
  KO
K10084  ER degradation enhancer, mannosidase alpha-like 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9695 (EDEM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    9695 (EDEM1)
Lectins [BR:hsa04091]
 M-type lectins
  9695 (EDEM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_47
Motif
Other DBs
NCBI-GeneID: 9695
NCBI-ProteinID: NP_055489
OMIM: 607673
HGNC: 18967
Ensembl: ENSG00000134109
Vega: OTTHUMG00000154896
Pharos: Q92611(Tbio)
UniProt: Q92611 A0A024R2D5
Position
3p26.1
AA seq 657 aa AA seqDB search
MQWRALVLGLVLLRLGLHGVLWLVFGLGPSMGFYQRFPLSFGFQRLRSPDGPASPTSGPV
GRPGGVSGPSWLQPPGTGAAQSPRKAPRRPGPGMCGPANWGYVLGGRGRGPDEYEKRYSG
AFPPQLRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLG
NYSLTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRI
ITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDTNNE
TCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVG
KQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLY
VNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERYNWQL
QAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDK
STEDRMESFFLSETCKYLYLLFDEDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFS
EEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGLI
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgcaatggcgagcgctcgtcctggggctggtgctcctccggcttggcctccatggagta
ttgtggctcgtcttcgggctggggcccagcatgggcttctaccagcgctttccgctcagc
ttcggcttccagcgtctgaggagccccgacggccccgcgtcgcccacctcggggcccgtg
ggccggcctgggggggtatccgggccgtcgtggctgcagccgccggggaccggggcagcg
cagagcccgcgcaaggctccgcggcgtcctgggccggggatgtgcggcccagccaactgg
ggctacgtgctgggcggccggggccgcggcccggacgagtacgagaagcgctacagcggc
gccttccctccgcagctgcgtgcccagatgcgcgacctggcacggggcatgttcgtcttt
ggctacgacaactacatggctcacgccttcccccaggacgagctcaaccccatccactgc
cgcggccgtgggcccgaccgcggggacccttcaaatctgaacatcaatgatgtactaggg
aactactcattgactcttgttgatgcattggatacacttgcaataatgggaaattcatcc
gagttccagaaagccgtcaagttagtgatcaacacagtttcatttgacaaagattccacc
gtccaagtctttgaggccacgataagggtcctgggaagcctcctttctgctcacagaata
ataactgactccaagcagccctttggtgacatgacaattaaggactatgataatgagttg
ttatacatggcccatgacctggcggtgcggctcctccctgcttttgaaaacaccaagaca
gggattccatatcctcgggtgaatctaaagacaggagttcctcctgacaccaataatgag
acatgcacagcgggagccggttccctcctggtggaatttgggattctgagtcgactcctg
ggggactccacatttgagtgggtggccagacgagcagtgaaagccctttggaacctccgg
agcaatgatacaggattactaggcaatgtcgtgaacattcagacgggccactgggttgga
aagcagagtggcctgggtgccgggctggactccttctatgaatacctcttgaaatcttac
attctctttggagaaaaagaagacctagaaatgtttaatgctgcatatcagagtattcag
aactacttaagaagagggcgggaagcctgcaatgaaggagaaggagaccctccactctat
gtcaacgtgaacatgttcagtgggcagctgatgaacacctggattgactctctgcaggcc
tttttccctggactgcaggtgctgataggagatgtggaagatgccatctgccttcatgcc
ttctactatgccatatggaaacgatatggtgccctccctgagagatataactggcagctg
caggcccctgacgttctcttctacccactgagaccagagttagtggaatccacatatctc
ctctaccaggcaaccaagaatcccttctacctccatgtaggaatggatattctgcagagt
ctggaaaagtacacaaaagtcaagtgtgggtacgccacgctgcatcacgtcattgacaag
tccacagaagaccggatggagagcttctttctcagtgagacctgtaaatatttgtatctg
ctgtttgatgaagacaatccagtacacaagtctggaaccagatacatgttcacaacagag
ggacacattgtatctgtggatgagcatcttcgggaattgccatggaaggaattcttctct
gaagagggagggcaggaccaagggggaaagtctgtgcacaggccgaaacctcatgagtta
aaagtcatcaactccagctccaactgcaatcgtgtacctgatgagaggaggtactccctg
cccttaaagagcatctacatgcgacagattgaccagatggttggtttgatttga

DBGET integrated database retrieval system