KEGG   Homo sapiens (human): 97Help
Entry
97                CDS       T01001                                 

Gene name
ACYP1, ACYPE
Definition
(RefSeq) acylphosphatase 1
  KO
K01512  acylphosphatase [EC:3.6.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00620  Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    97 (ACYP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.7  acylphosphatase
     97 (ACYP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acylphosphatase
Motif
Other DBs
NCBI-GeneID: 97
NCBI-ProteinID: NP_001098
OMIM: 600875
HGNC: 179
Ensembl: ENSG00000119640
Vega: OTTHUMG00000171767
Pharos: P07311(Tbio)
UniProt: P07311
Structure
PDB: 

Position
14q24.3
AA seq 99 aa AA seqDB search
MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVR
HMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaggaaacaccctgatatcagtggattatgaaatttttgggaaggtgcaaggg
gtgtttttccgtaagcatactcaggctgagggtaaaaagctgggattggtaggctgggtc
cagaacactgaccggggcacagtgcaaggacaattgcaaggtcccatctccaaggtgcgt
catatgcaggaatggcttgaaacaagaggaagtcctaaatcacacatcgacaaagcaaac
ttcaacaatgaaaaagtcatcttgaagttggattactcagacttccaaattgtaaaataa

DBGET integrated database retrieval system