KEGG   Homo sapiens (human): 97
Entry
97                CDS       T01001                                 

Gene name
ACYP1, ACYPE
Definition
(RefSeq) acylphosphatase 1
  KO
K01512  acylphosphatase [EC:3.6.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    97 (ACYP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.7  acylphosphatase
     97 (ACYP1)
SSDB
Motif
Pfam: Acylphosphatase
Other DBs
NCBI-GeneID: 97
NCBI-ProteinID: NP_001098
OMIM: 600875
HGNC: 179
Ensembl: ENSG00000119640
Vega: OTTHUMG00000171767
Pharos: P07311(Tbio)
UniProt: P07311
Structure
PDB: 
6CBU 2VH7 2W4C 2W4P 2K7K

Position
14q24.3
AA seq 99 aa
MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVR
HMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
NT seq 300 nt   +upstreamnt  +downstreamnt
atggcagaaggaaacaccctgatatcagtggattatgaaatttttgggaaggtgcaaggg
gtgtttttccgtaagcatactcaggctgagggtaaaaagctgggattggtaggctgggtc
cagaacactgaccggggcacagtgcaaggacaattgcaaggtcccatctccaaggtgcgt
catatgcaggaatggcttgaaacaagaggaagtcctaaatcacacatcgacaaagcaaac
ttcaacaatgaaaaagtcatcttgaagttggattactcagacttccaaattgtaaaataa

KEGG   Homo sapiens (human): 98
Entry
98                CDS       T01001                                 

Gene name
ACYP2, ACYM, ACYP
Definition
(RefSeq) acylphosphatase 2
  KO
K01512  acylphosphatase [EC:3.6.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    98 (ACYP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.7  acylphosphatase
     98 (ACYP2)
SSDB
Motif
Pfam: Acylphosphatase
Other DBs
NCBI-GeneID: 98
NCBI-ProteinID: NP_612457
OMIM: 102595
HGNC: 180
Ensembl: ENSG00000170634
Vega: OTTHUMG00000129287
Pharos: P14621(Tbio)
UniProt: P14621 A0A140VJD7
Position
2p16.2
AA seq 99 aa
MSTAQSLKSVDYEVFGRVQGVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVN
SMKSWLSKVGSPSSRIDRTNFSNEKTISKLEYSNFSIRY
NT seq 300 nt   +upstreamnt  +downstreamnt
atgtctaccgcccagtcactcaaatccgtggactacgaggtgttcggaagagtgcagggt
gtttgcttcagaatgtatacagaagatgaagctaggaaaataggagtggttggctgggtg
aagaataccagcaaaggcaccgtgacaggccaagtgcaggggccagaagacaaagtcaat
tccatgaagtcctggctgagcaaggttggaagccctagttctcgcattgaccgcacaaac
ttttctaatgaaaaaaccatctctaagcttgaatactctaattttagtattagatactaa

DBGET integrated database retrieval system