KEGG   Homo sapiens (human): 970Help
Entry
970               CDS       T01001                                 

Gene name
CD70, CD27-L, CD27L, CD27LG, LPFS3, TNFSF7, TNLG8A
Definition
(RefSeq) CD70 molecule
  KO
K05470  tumor necrosis factor ligand superfamily member 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Drug target
Vorsetuzumab: D10342
Vorsetuzumab mafodotin: D10341
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    970 (CD70)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    970 (CD70)
   04090 CD molecules [BR:hsa04090]
    970 (CD70)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Tumor necrosis fators
   970 (CD70)
CD molecules [BR:hsa04090]
 Proteins
  970 (CD70)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 970
NCBI-ProteinID: NP_001243
OMIM: 602840
HGNC: 11937
Ensembl: ENSG00000125726
Vega: OTTHUMG00000181834
Pharos: P32970(Tbio)
UniProt: P32970 A0A0U5JA32
Position
19p13.3
AA seq 193 aa AA seqDB search
MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAEL
QLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTA
SRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRN
TDETFFGVQWVRP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggagggttcgggctgctcggtgcggcgcaggccctatgggtgcgtcctgcgg
gctgctttggtcccattggtcgcgggcttggtgatctgcctcgtggtgtgcatccagcgc
ttcgcacaggctcagcagcagctgccgctcgagtcacttgggtgggacgtagctgagctg
cagctgaatcacacaggacctcagcaggaccccaggctatactggcaggggggcccagca
ctgggccgctccttcctgcatggaccagagctggacaaggggcagctacgtatccatcgt
gatggcatctacatggtacacatccaggtgacgctggccatctgctcctccacgacggcc
tccaggcaccaccccaccaccctggccgtgggaatctgctctcccgcctcccgtagcatc
agcctgctgcgtctcagcttccaccaaggttgtaccattgcctcccagcgcctgacgccc
ctggcccgaggggacacactctgcaccaacctcactgggacacttttgccttcccgaaac
actgatgagaccttctttggagtgcagtgggtgcgcccctga

DBGET integrated database retrieval system