KEGG   Homo sapiens (human): 9701
Entry
9701              CDS       T01001                                 

Gene name
PPP6R2, KIAA0685, PP6R2, SAP190, SAPS2
Definition
(RefSeq) protein phosphatase 6 regulatory subunit 2
  KO
K15500  serine/threonine-protein phosphatase 6 regulatory subunit 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    9701 (PPP6R2)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    9701 (PPP6R2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-6
    Regulatory subunits
     9701 (PPP6R2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   Other DSBR factors
    Protein phosphatase 6
     9701 (PPP6R2)
SSDB
Motif
Pfam: SAPS
Other DBs
NCBI-GeneID: 9701
NCBI-ProteinID: NP_001229827
OMIM: 610877
HGNC: 19253
Ensembl: ENSG00000100239
Vega: OTTHUMG00000150199
Pharos: O75170(Tdark)
UniProt: O75170
Position
22q13.33
AA seq 959 aa
MFWKFDLNTTSHVDKLLDKEHVTLQELMDEDDILQECKAQNQKLLDFLCRQQCMEELVSL
ITQDPPLDMEEKVRFKYPNTACELLTCDVPQISDRLGGDESLLSLLYDFLDHEPPLNPLL
ASFFSKTIGNLIARKTEQVITFLKKKDKFISLVLKHIGTSALMDLLLRLVSCVEPAGLRQ
DVLHWLNEEKVIQRLVELIHPSQDEDRQSNASQTLCDIVRLGRDQGSQLQEALEPDPLLT
ALESQDCVEQLLKNMFDGDRTESCLVSGTQVLLTLLETRRVGTEGLVDSFSQGLERSYAV
SSSVLHGIEPRLKDFHQLLLNPPKKKAILTTIGVLEEPLGNARLHGARLMAALLHTNTPS
INQELCRLNTMDLLLDLFFKYTWNNFLHFQVELCIAAILSHAAREERTEASGSESRVEPP
HENGNRSLETPQPAASLPDNTMVTHLFQKCCLVQRILEAWEANDHTQAAGGMRRGNMGHL
TRIANAVVQNLERGPVQTHISEVIRGLPADCRGRWESFVEETLTETNRRNTVDLVSTHHL
HSSSEDEDIEGAFPNELSLQQAFSDYQIQQMTANFVDQFGFNDEEFADQDDNINAPFDRI
AEINFNIDADEDSPSAALFEACCSDRIQPFDDDEDEDIWEDSDTRCAARVMARPRFGAPH
ASESCSKNGPERGGQDGKASLEAHRDAPGAGAPPAPGKKEAPPVEGDSEGAMWTAVFDEP
ANSTPTAPGVVRDVGSSVWAAGTSAPEEKGWAKFTDFQPFCCSESGPRCSSPVDTECSHA
EGSRSQGPEKAFSPASPCAWNVCVTRKAPLLASDSSSSGGSHSEDGDQKAASAMDAVSRG
PGREAPPLPTVARTEEAVGRVGCADSRLLSPACPAPKEVTAAPAVAVPPEATVAITTALS
KAGPAIPTPAVSSALAVAVPLGPIMAVTAAPAMVATLGTVTKDGKTDAPPEGAALNGPV
NT seq 2880 nt   +upstreamnt  +downstreamnt
atgttctggaagtttgacttgaacaccacgtcccatgttgacaagctgctggacaaggag
catgtgacgctgcaggagttaatggatgaagatgacatcttgcaggagtgtaaggctcag
aaccagaagctgctggacttcctgtgcaggcagcagtgcatggaggagctggtgagcctc
atcacacaggatccgcccctggacatggaggagaaggtccgcttcaaatatccaaacaca
gcctgtgagcttctgacttgtgatgtgccgcagatcagcgaccgcctcggtggggacgag
agcctgctgagcctcctgtacgacttcttggaccatgagccgcctctcaatcctctgctc
gccagttttttcagcaagaccattggcaatctcattgcaagaaaaaccgaacaggtgatt
acgtttttgaagaagaaggacaagttcatcagcctggtgttgaagcacatcggcacctca
gcgcttatggacctgctgctgcgcctggtcagctgtgtggagccagccgggctccggcag
gacgtcctgcactggctgaatgaagagaaggtcatccagaggcttgtggagttgatccac
ccgagccaggatgaagataggcagtcaaatgcttctcagactctctgtgacatagttagg
ctgggcagagaccagggcagtcagctgcaagaggctctggagccagacccgctcctcaca
gcgctggagtcgcaggactgtgtggagcagcttctgaagaacatgtttgatggagaccgg
acggagagctgcctcgtcagtgggactcaggtgttactcaccttgctggaaaccaggcgg
gttgggacagagggcttggtggactccttttctcagggactggaaaggtcatacgctgtc
agcagcagcgtactacacggcatcgagcctcggctgaaggacttccaccagctcctgctc
aacccgcccaagaagaaagcgatcctgaccaccattggtgtgctggaggagcccctgggg
aatgcccgtctgcatggcgcccgcctcatggcagcactgctgcacacaaacacacccagc
atcaaccaggagctctgccggctcaacacgatggacttactgctggacttgttctttaag
tacacctggaataactttttgcacttccaagtggaactatgcatagccgctattctctcc
cacgctgcccgtgaggagaggacagaagccagcggatccgagagcagggtggagcctccg
catgagaacgggaaccggagcctggagactccccagccggccgccagcctccctgacaac
acaatggtgacccacctgttccagaagtgctgcctggtgcagaggatcctggaggcctgg
gaagccaacgaccacacgcaggcagcgggtggcatgagacgtgggaacatgggccacctc
acacggatcgccaacgcggtggtgcagaacctggagcggggccctgtgcagacgcacatc
agcgaggtcatccgagggctccctgcggactgccgtggccgctgggagagcttcgtggag
gagacgctgacggagacgaaccgcaggaacactgtggacctggtgagcactcaccacctt
cactcctcaagtgaggacgaggacattgagggtgctttccctaacgagctgtcccttcag
caggccttctctgactaccagatccagcagatgacagccaacttcgtggatcagtttggc
ttcaatgatgaggagtttgccgaccaggacgacaacatcaatgccccgtttgacaggatc
gcagagatcaacttcaacatcgacgctgacgaggacagtcccagcgcagctctgtttgag
gcctgctgcagtgaccgcatccagccctttgatgatgatgaggacgaggacatctgggag
gacagtgacactcgctgtgctgcccgggtgatggccagacccaggtttggagccccccat
gcttcagagagttgctcaaagaatggcccagagcgtggaggccaggatgggaaggcgagc
ttggaagcacacagagatgcacctggggcaggtgccccaccggcccccgggaagaaggaa
gcgccccctgtggagggtgactcagaaggcgccatgtggacggcagtgtttgatgagcca
gcgaactcaacgcccacagccccaggagtggtgagggacgtgggttccagtgtgtgggca
gctggcacctcagctccagaggagaaaggctgggccaagttcactgacttccaacctttc
tgctgctccgagtcagggcccaggtgcagctctccggtggacacagaatgcagccatgct
gagggcagccggagccaaggccctgagaaagccttcagcccggcttctccatgtgcctgg
aacgtgtgtgtcaccaggaaggcccccctgctggcctctgacagtagctcctctgggggc
tcccacagcgaggatggcgaccagaaggcagcgagtgccatggatgcggtgagcaggggt
cccggccgggaggcccccccgctgcccacagtggccaggacagaggaggctgtcggcagg
gtcgggtgtgctgacagccggctgttaagccctgcctgccccgcgccaaaggaagtgact
gctgccccagccgtggctgtgccccccgaggctactgtggccatcaccacagcactgagc
aaggctggccccgccatacccaccccagcagtctcttctgcactggccgtggcggtcccc
ctagggcccatcatggcagtcacagcagccccagccatggtggccaccctggggacagtg
acaaaggacgggaagacagatgccccgccagaaggagctgccttaaatggcccagtgtga

DBGET integrated database retrieval system