KEGG   Homo sapiens (human): 9702
Entry
9702              CDS       T01001                                 
Symbol
CEP57, MVA2, PIG8, TSP57
Name
(RefSeq) centrosomal protein 57
  KO
K16762  centrosomal protein CEP57
Organism
hsa  Homo sapiens (human)
Disease
H01288  Mosaic variegated aneuploidy syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9702 (CEP57)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    9702 (CEP57)
SSDB
Motif
Pfam: Cep57_CLD Cep57_MT_bd TRIQK
Other DBs
NCBI-GeneID: 9702
NCBI-ProteinID: NP_055494
OMIM: 607951
HGNC: 30794
Ensembl: ENSG00000166037
Pharos: Q86XR8(Tbio)
UniProt: Q86XR8
Structure
Position
11:95790498..95832693
AA seq 500 aa
MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLA
YPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKN
EESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQT
HVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKRMQAKAAELQTGLET
NRLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPFVAGKSTSPS
HAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTPPSSNGINEEL
SEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRK
YQAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKLRPGEKRRKNLQL
LKDMQSIQNSLQSSSLCWDY
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggcggcggcgtctgtctctgcggcttctggttctcacttgtcgaacagctttgctgag
ccatcaaggtctaatggaagcatggttcggcattcttcatctccatatgtagtatatcct
tcggataagcctttccttaatagtgatctacgacgctccccaagtaagcctacacttgcc
tatccagaaagcaacagcagagccatattttctgctcttaagaatcttcaagataagatt
cgacgcttggaacttgagaggattcaggcagaagaaagtgtgaaaaccttgtctagagaa
acaattgaatataagaaagtactggatgaacagatacaagaaagggagaattcaaagaat
gaggaatcaaagcacaatcaagaactgacatctcagttgttagctgcagaaaataaatgc
aatctattagaaaaacaattggaatacatgcgaaatatgataaagcatgccgaaatggag
aggacatctgtcttagagaaacaagtttccctagaaagagaacgacaacatgatcaaaca
catgttcagagccaacttgaaaaattggatcttcttgaacaggagtataacaaacttacc
acaatgcaggcccttgcagaaaaaaaaatgcaagagttggaagcaaaactccatgaagaa
gaacaggaaaggaaacgcatgcaagctaaggcagctgagttgcagactggtctagaaaca
aatagacttatctttgaagataaggcaactccgtgtgttcccaatgcaagaagaattaaa
aaaaagaagtcaaaaccaccagaaaagaaaagttctaggaactattttggtgcacaacca
cattatagattatgcttgggtgatatgccatttgtagctgggaagtccacaagccctagc
catgccgtggtagccaatgttcagcttgtcttgcatctaatgaagcaacacagtaaagct
ttgtgcaatgatcgagtcatcaacagtattcctttggcaaagcaagtatcttcacgaggt
ggtaaaagtaagaagttgtcagtaacacctccctcctccaacggtattaatgaggagttg
tcagaagtcttacagactttacaggatgaatttgggcaaatgagctttgatcaccagcag
cttgcaaaacttatccaggagtcgccaaccgttgaactgaaagacaagttggagtgtgaa
ttggaggcattagtgggaaggatggaagcaaaagccaaccaaataactaaagttcgaaaa
taccaagcccagctggagaaacagaagttagagaagcagaagaaggaattaaaagctacc
aaaaagactcttgatgaagaaagaaacagcagcagccgttctggaatcacagggaccaca
aataagaaagattttatgaaactgagacctggagaaaaaaggagaaaaaatcttcagtta
ttgaaggacatgcaaagcatacagaattcattacaaagcagtagtttgtgttgggattac
tga

DBGET integrated database retrieval system