KEGG   Homo sapiens (human): 9709
Entry
9709              CDS       T01001                                 

Symbol
HERPUD1, HERP, Mif1, SUP
Name
(RefSeq) homocysteine inducible ER protein with ubiquitin like domain 1
  KO
K14027  homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9709 (HERPUD1)
SSDB
Motif
Pfam: ubiquitin DUF2407
Other DBs
NCBI-GeneID: 9709
NCBI-ProteinID: NP_055500
OMIM: 608070
HGNC: 13744
Ensembl: ENSG00000051108
Vega: OTTHUMG00000133276
Pharos: Q15011(Tbio)
UniProt: Q15011 Q53FP9
Structure
PDB: 
1WGD

Position
16q13
AA seq 391 aa
MESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSG
KLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDS
SSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQ
YYMQYLAATAASGAFVPPPSAQEIPVVSAPAPAPIHNQFPAENQPANQNAAPQVVVNPGA
NQNLRMNAQGGPIVEEDDEINRDWLDWTYSAATFSVFLSILYFYSSLSRFLMVMGATVVM
YLHHVGWFPFRPRPVQNFPNDGPPPDVVNQDPNNNLQEGTDPETEDPNHLPPDRDVLDGE
QTSPSFMSTAWLVFKTFFASLLPEGPPAIAN
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggagtccgagaccgaacccgagcccgtcacgctcctggtgaagagccccaaccagcgc
caccgcgacttggagctgagtggcgaccgcggctggagtgtgggccacctcaaggcccac
ctgagccgcgtctaccccgagcgtccgcgtccagaggaccagaggttaatttattctggg
aagctgttgttggatcaccaatgtctcagggacttgcttccaaagcaggaaaaacggcat
gttttgcatctggtgtgcaatgtgaagagtccttcaaaaatgccagaaatcaacgccaag
gtggctgaatccacagaggagcctgctggttctaatcggggacagtatcctgaggattcc
tcaagtgatggtttaaggcaaagggaagttcttcggaacctttcttcccctggatgggaa
aacatctcaaggcctgaagctgcccagcaggcattccaaggcctgggtcctggtttctcc
ggttacacaccctatgggtggcttcagctttcctggttccagcagatatatgcacgacag
tactacatgcaatatttagcagccactgctgcatcaggggcttttgttccaccaccaagt
gcacaagagatacctgtggtctctgcacctgctccagcccctattcacaaccagtttcca
gctgaaaaccagcctgccaatcagaatgctgctcctcaagtggttgttaatcctggagcc
aatcaaaatttgcggatgaatgcacaaggtggccctattgtggaagaagatgatgaaata
aatcgagattggttggattggacctattcagcagctacattttctgtttttctcagtatc
ctctacttctactcctccctgagcagattcctcatggtcatgggggccaccgttgttatg
tacctgcatcacgttgggtggtttccatttagaccgaggccggttcagaacttcccaaat
gatggtcctcctcctgacgttgtaaatcaggaccccaacaataacttacaggaaggcact
gatcctgaaactgaagaccccaaccacctccctccagacagggatgtactagatggcgag
cagaccagcccctcctttatgagcacagcatggcttgtcttcaagactttctttgcctct
cttcttccagaaggccccccagccatcgcaaactga

DBGET integrated database retrieval system