KEGG   Homo sapiens (human): 971
Entry
971               CDS       T01001                                 

Symbol
CD72, CD72b, LYB2
Name
(RefSeq) CD72 molecule
  KO
K06504  CD72 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    971 (CD72)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    971 (CD72)
   04091 Lectins [BR:hsa04091]
    971 (CD72)
CD molecules [BR:hsa04090]
 Proteins
  971 (CD72)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   971 (CD72)
SSDB
Motif
Pfam: Lectin_C UL45 Exonuc_VII_L DMPK_coil DUF1664 DUF3450 Neur_chan_memb DUF3611 FapA
Other DBs
NCBI-GeneID: 971
NCBI-ProteinID: NP_001773
OMIM: 107272
HGNC: 1696
Ensembl: ENSG00000137101
Vega: OTTHUMG00000019870
Pharos: P21854(Tbio)
UniProt: P21854 Q5TLG3
Position
9p13.3
AA seq 359 aa
MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLG
DKAAVKSEQPTASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQ
VSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQA
AEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMH
QKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTG
LSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggctgaggccatcacctatgcagatctgaggtttgtgaaggctcccctgaagaagagc
atctccagccggttaggacaggacccaggggctgatgatgatggggaaatcacctacgag
aatgttcaagtgcccgcagtcctaggggtgccctcaagcttggcttcttctgtactaggg
gacaaagcagcggtcaagtcggagcagccaactgcgtcctggagagccgtgacgtcacca
gctgtcgggcggattctcccctgccgcacaacctgcctgcgatacctcctgctcggcctg
ctcctcacctgcctgctgttaggagtgaccgccatctgcctgggagtgcgctatctgcag
gtgtctcagcagctccagcagacgaacagggttctggaagtcactaacagcagcctgagg
cagcagctccgcctcaagataacgcagctgggacagagtgcagaggatctgcaggggtcc
aggagagagctggcgcagagtcaggaagcactacaggtggaacagagggctcatcaggcg
gccgaagggcagctacaggcctgccaggcagacagacagaagacgaaggagaccttgcaa
agtgaggagcaacagaggagggccttggagcagaagctgagcaacatggagaacagactg
aagcccttcttcacatgcggctcagcagacacctgctgtccgtcgggatggataatgcat
cagaaaagctgcttttacatctcacttacttcaaaaaattggcaggagagccaaaaacaa
tgtgaaactctgtcttccaagctggccacattcagtgaaatttatccacaatcacactct
tactacttcttaaattcactgttgccaaatggtggttcagggaattcatattggactggc
ctcagctctaacaaggattggaagttgactgatgatacacaacgcactaggacttatgct
caaagctcaaaatgtaacaaggtacataaaacttggtcatggtggacactggagtcagag
tcatgtagaagttctcttccctacatctgtgagatgacagctttcaggtttccagattag

DBGET integrated database retrieval system