KEGG   Homo sapiens (human): 9716Help
Entry
9716              CDS       T01001                                 

Gene name
AQR, IBP160, fSAP164
Definition
(RefSeq) aquarius intron-binding spliceosomal factor
  KO
K12874  intron-binding protein aquarius
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    9716 (AQR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    9716 (AQR)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19-related factors
    9716 (AQR)
 Complex C
    9716 (AQR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aquarius_N AAA_11 AAA_12 AAA_19 AAA_30 ResIII Parvo_NS1 DUF2075 DEAD UvrD_C_2 AAA_16 AAA UvrD-helicase DnaB_C DUF4088 PhoH AAA_22 RecA
Motif
Other DBs
NCBI-GeneID: 9716
NCBI-ProteinID: NP_055506
OMIM: 610548
HGNC: 29513
Ensembl: ENSG00000021776
Vega: OTTHUMG00000172257
Pharos: O60306(Tdark)
UniProt: O60306 A0A024R9L1
Structure
PDB: 

Position
15q14
AA seq 1485 aa AA seqDB search
MAAPAQPKKIVAPTVSQINAEFVTQLACKYWAPHIKKKSPFDIKVIEDIYEKEIVKSRFA
IRKIMLLEFSQYLENYLWMNYSPEVSSKAYLMSICCMVNEKFRENVPAWEIFKKKPDHFP
FFFKHILKAALAETDGEFSLHEQTVLLLFLDHCFNSLEVDLIRSQVQQLISLPMWMGLQL
ARLELELKKTPKLRKFWNLIKKNDEKMDPEAREQAYQERRFLSQLIQKFISVLKSVPLSE
PVTMDKVHYCERFIELMIDLEALLPTRRWFNTILDDSHLLVHCYLSNLVRREEDGHLFSQ
LLDMLKFYTGFEINDQTGNALTENEMTTIHYDRITSLQRAAFAHFPELYDFALSNVAEVD
TRESLVKFFGPLSSNTLHQVASYLCLLPTLPKNEDTTFDKEFLLELLVSRHERRISQIQQ
LNQMPLYPTEKIIWDENIVPTEYYSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTYE
IRQDIEDSVSRMKPWQSEYGGVVFGGWARMAQPIVAFTVVEVAKPNIGENWPTRVRADVT
INLNVRDHIKDEWEGLRKHDVCFLITVRPTKPYGTKFDRRRPFIEQVGLVYVRGCEIQGM
LDDKGRVIEDGPEPRPNLRGESRTFRVFLDPNQYQQDMTNTIQNGAEDVYETFNIIMRRK
PKENNFKAVLETIRNLMNTDCVVPDWLHDIILGYGDPSSAHYSKMPNQIATLDFNDTFLS
IEHLKASFPGHNVKVTVEDPALQIPPFRITFPVRSGKGKKRKDADVEDEDTEEAKTLIVE
PHVIPNRGPYPYNQPKRNTIQFTHTQIEAIRAGMQPGLTMVVGPPGTGKTDVAVQIISNI
YHNFPEQRTLIVTHSNQALNQLFEKIMALDIDERHLLRLGHGEEELETEKDFSRYGRVNY
VLARRIELLEEVKRLQKSLGVPGDASYTCETAGYFFLYQVMSRWEEYISKVKNKGSTLPD
VTEVSTFFPFHEYFANAPQPIFKGRSYEEDMEIAEGCFRHIKKIFTQLEEFRASELLRSG
LDRSKYLLVKEAKIIAMTCTHAALKRHDLVKLGFKYDNILMEEAAQILEIETFIPLLLQN
PQDGFSRLKRWIMIGDHHQLPPVIKNMAFQKYSNMEQSLFTRFVRVGVPTVDLDAQGRAR
ASLCNLYNWRYKNLGNLPHVQLLPEFSTANAGLLYDFQLINVEDFQGVGESEPNPYFYQN
LGEAEYVVALFMYMCLLGYPADKISILTTYNGQKHLIRDIINRRCGNNPLIGRPNKVTTV
DRFQGQQNDYILLSLVRTRAVGHLRDVRRLVVAMSRARLGLYIFARVSLFQNCFELTPAF
SQLTARPLHLHIIPTEPFPTTRKNGERPSHEVQIIKNMPQMANFVYNMYMHLIQTTHHYH
QTLLQLPPAMVEEGEEVQNQETELETEEEAMTVQADIIPSPTDTSCRQETPAFQTDTTPS
ETGATSTPEAIPALSETTPTVVGAVSAPAEANTPQDATSAPEETK
NT seq 4458 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccctgcgcagcccaagaagatcgtggcccctacggtgtcccaaatcaatgcg
gagttcgtgacccagttagcatgtaaatactgggctccccacatcaagaagaaatcacct
tttgatataaaggttattgaagatatatatgaaaaagagattgtcaaatcaaggtttgct
attagaaagataatgctcttggaatttagccagtatcttgaaaattatctctggatgaat
tattctcctgaggtatctagcaaggcctatttaatgtcaatctgctgtatggtgaatgag
aagtttagagaaaacgtgcctgcatgggagatttttaagaagaagccagaccacttccca
ttcttttttaaacacatcttgaaggcggcattagctgaaactgatggtgaattttcactt
catgaacagacagtcttactactttttcttgatcattgcttcaatagtttggaagtagac
ttgatacgaagtcaagtacagcagcttatctccctcccaatgtggatgggcttacagctg
gcacgattggaattagaattaaaaaagacacctaagctaagaaaattctggaacttgatt
aaaaagaatgatgaaaagatggatccagaagcaagagaacaggcatatcaagagaggaga
tttctttcacaactcatccagaagtttatctctgtgctgaaatcagtcccactttctgaa
cctgtcactatggacaaagttcattactgtgaaagattcattgaacttatgattgatcta
gaggccctgctacccacaaggcgctggtttaataccatcctggatgattcccaccttctg
gttcactgttacctttccaatcttgttcgtagagaagaggatggccatcttttttcccag
cttttggacatgcttaaattctatactggttttgaaattaatgaccaaactggaaatgct
ctgacagagaatgagatgaccacaattcactatgatagaattacttctctacagagagct
gcttttgcacattttcctgaactctatgattttgccctctcaaatgtggcagaagtagat
actcgggagtccttggtcaagttttttggacctcttagttcaaacacactccaccaggtg
gcatcatacctctgcttgttgccaactcttcctaaaaatgaagacacaacttttgataaa
gaatttcttctagaattgctggtatctcgtcatgaacgtcgaatttctcagattcagcag
ttgaaccagatgcctttgtatccaactgagaaaattatatgggatgaaaatattgtccca
actgagtactattctggagaaggttgtcttgctcttcccaaattgaatttgcagtttttg
actcttcatgactacctgctaaggaactttaacctcttccgcttagaatcaacttatgaa
attcgtcaggacattgaagatagtgtcagcagaatgaagccatggcaatctgaatatggc
ggtgtagtgtttggtggttgggcgcgaatggcccagcccattgtggctttcactgtcgtt
gaagtggccaaacccaacataggtgaaaactggccaacccgagttcgtgcagatgttacc
ataaatctcaatgtcagagatcacatcaaagatgaatgggaaggtcttcgtaagcatgat
gtatgctttttaattaccgtacgtcccacaaaaccttatggcactaagtttgaccggagg
agaccttttattgagcaggttggcctggtttatgtcagaggctgtgaaattcagggcatg
ctggatgataaaggacgtgtcattgaagatggacctgaacccagacccaatcttagagga
gaatcaaggacatttagagtgtttttggatccaaaccagtatcaacaagatatgaccaat
actatacaaaatggagcagaggatgtgtatgaaacttttaatataataatgaggagaaaa
ccaaaggaaaataactttaaggctgtgctggagactattcggaacctgatgaatactgat
tgtgtggtacctgactggctgcacgatatcattttaggttatggggacccaagtagtgca
cattattcgaaaatgcccaatcagattgccacccttgatttcaatgatacatttctctcc
attgagcatttaaaagccagcttccctggtcataatgttaaagtaactgtagaagaccct
gctctacaaataccccctttcaggataacttttccagtaagaagtggaaaagggaagaaa
aggaaagatgcggatgtggaagatgaagacaccgaggaagcaaaaaccttaattgttgag
ccccatgttattcctaataggggtccttatccttataatcaacccaaacgtaatacgatt
cagttcactcatacacagatagaagccatccgtgctggaatgcagcctgggctgactatg
gttgtgggcccacctggtacaggcaaaacagatgtggcagttcagatcatatccaacatc
taccacaacttcccagaacagaggactctaattgttactcattccaatcaggccctaaac
cagttgtttgagaaaatcatggcattagacattgatgagcgccacctactgcgtcttggt
catggagaagaagagctggagacagagaaagatttcagcaggtatggaagagttaattat
gttctggctcgaagaatagaacttttagaagaagtcaaacgattgcaaaagagtctaggg
gttccaggagatgcctcatatacctgtgaaactgcaggctatttcttcttataccaggta
atgtctcgctgggaagagtatatcagcaaagtgaaaaataaaggtagtacattgccagat
gttacggaagtctccactttcttccctttccatgaatactttgcaaatgctcctcaaccc
atttttaaaggaagatcttatgaagaagacatggaaattgctgaaggatgtttcaggcat
attaagaaaatctttacgcagcttgaggaattcagagcctctgaattgcttcgaagtgga
ctggacagatctaaataccttttagtgaaagaagccaaaattattgctatgacctgtact
catgctgccttaaaacgacatgacttggtcaagctaggtttcaagtatgacaacattttg
atggaagaggctgctcagattctggagatagaaacttttatccctcttcttctacagaat
cctcaggatggatttagccgactaaaacgatggattatgattggcgatcatcaccagtta
cctccagttattaagaacatggcctttcaaaagtactcaaacatggagcagtctctcttc
actcgctttgttcgcgttggagttccgactgttgaccttgatgctcaagggagagccaga
gcaagcttgtgcaacctctacaactggcgatacaagaatctaggaaacttaccccatgtg
cagctcttgccagagtttagtacagcaaatgctggcttactgtatgacttccagctcatt
aatgttgaagattttcaaggagtgggagaatctgaacctaatccttacttctatcagaat
cttggagaggcagaatatgtagtagcactttttatgtacatgtgtttacttggttaccct
gctgacaaaatcagtattctaacaacatataatggccaaaagcatcttattcgcgacatc
atcaatagacgatgtggaaacaatccattgattggaagaccaaacaaggtgacaactgtt
gatagatttcaaggtcaacagaatgactatattcttctttctctggtacgaaccagggca
gtgggccatctgagggatgtccgtcgcttggtagtggccatgtctagagccagacttgga
ctttatatcttcgccagagtatccctcttccaaaactgttttgaactgactccagctttc
agtcagctcacagctcgcccccttcatttgcatataattccaacagaacctttcccaact
actagaaagaatggagagagaccatctcatgaagtacaaataataaaaaatatgccccag
atggcaaactttgtatacaacatgtacatgcatttgatacagactacacatcattatcat
cagactttattacaactaccacctgctatggtagaagagggtgaggaagttcaaaatcaa
gaaacagaattggaaacagaagaagaggccatgactgttcaagctgacatcatacccagt
ccaacagacaccagctgccgtcaagaaactccagcctttcaaactgacaccacccccagt
gagacaggagccacttccactccagaagccatccctgctttatctgagaccacccctact
gtggtaggagctgtatctgcaccggcagaagctaacacacctcaggatgccacatctgcc
ccggaagagaccaagtag

DBGET integrated database retrieval system