KEGG   Homo sapiens (human): 9718Help
Entry
9718              CDS       T01001                                 

Gene name
ECE2, EEF1AKMT4
Definition
(RefSeq) endothelin converting enzyme 2
  KO
K01415  endothelin-converting enzyme [EC:3.4.24.71]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    9718 (ECE2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9718 (ECE2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.71  endothelin-converting enzyme 1
     9718 (ECE2)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M13: neprilysin family
   9718 (ECE2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   9718 (ECE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M13_N Peptidase_M13 Peptidase_M48 DUF4368
Motif
Other DBs
NCBI-GeneID: 9718
NCBI-ProteinID: NP_001093590
OMIM: 610145
HGNC: 13275
Ensembl: ENSG00000145194
Vega: OTTHUMG00000150551
Pharos: O60344(Tbio)
UniProt: P0DPD6 P0DPD8
Position
3q27.1
AA seq 811 aa AA seqDB search
MNVALQELGAGSNMVEYKRATLRDEDAPETPVEGGASPDAMEVGKGASPFSPGPSPGMTP
GTPRSSGLFWRVTCPHLRSISGLCSRTMVGFQKGTRQLLGSRTQLELVLAGASLLLAALL
LGCLVALGVQYHRDPSHSTCLTEACIRVAGKILESLDRGVSPCEDFYQFSCGGWIRRNPL
PDGRSRWNTFNSLWDQNQAILKHLLENTTFNSSSEAEQKTQRFYLSCLQVERIEELGAQP
LRDLIEKIGGWNITGPWDQDNFMEVLKAVAGTYRATPFFTVYISADSKSSNSNVIQVDQS
GLFLPSRDYYLNRTANEKVLTAYLDYMEELGMLLGGRPTSTREQMQQVLELEIQLANITV
PQDQRRDEEKIYHKMSISELQALAPSMDWLEFLSFLLSPLELSDSEPVVVYGMDYLQQVS
ELINRTEPSILNNYLIWNLVQKTTSSLDRRFESAQEKLLETLYGTKKSCVPRWQTCISNT
DDALGFALGSLFVKATFDRQSKEIAEGMISEIRTAFEEALGQLVWMDEKTRQAAKEKADA
IYDMIGFPDFILEPKELDDVYDGYEISEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWS
MTPQTVNAYYLPTKNEIVFPAGILQAPFYARNHPKALNFGGIGVVMGHELTHAFDDQGRE
YDKEGNLRPWWQNESLAAFRNHTACMEEQYNQYQVNGERLNGRQTLGENIADNGGLKAAY
NAYKAWLRKHGEEQQLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRV
LGTLSNSRDFLRHFGCPVGSPMNPGQLCEVW
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcgcgctgcaggagctgggagctggcagcaacatggtggagtacaaacgggcc
acgcttcgggatgaagacgcacccgagacccccgtagagggcggggcctccccggacgcc
atggaggtgggcaagggggcttcccctttctcaccaggccccagccctggcatgacgcct
ggcacacccaggagctctgggctgttctggagggtcacctgcccccacctccgctccatc
tctggcctctgctctaggactatggtgggattccagaaggggacaagacagctgttaggc
tcacgcacgcagctggagctggtcttagcaggtgcctctctactgctggctgcactgctt
ctgggctgccttgtggccctaggggtccagtaccacagagacccatcccacagcacctgc
cttacagaggcctgcattcgagtggctggaaaaatcctggagtccctggaccgaggggtg
agcccctgtgaggacttttaccagttctcctgtgggggctggattcggaggaaccccctg
cccgatgggcgttctcgctggaacaccttcaacagcctctgggaccaaaaccaggccata
ctgaagcacctgcttgaaaacaccaccttcaactccagcagtgaagctgagcagaagaca
cagcgcttctacctatcttgcctacaggtggagcgcattgaggagctgggagcccagcca
ctgagagacctcattgagaagattggtggttggaacattacggggccctgggaccaggac
aactttatggaggtgttgaaggcagtagcagggacctacagggccaccccattcttcacc
gtctacatcagtgccgactctaagagttccaacagcaatgttatccaggtggaccagtct
gggctctttctgccctctcgggattactacttaaacagaactgccaatgagaaagtgctc
actgcctatctggattacatggaggaactggggatgctgctgggtgggcggcccacctcc
acgagggagcagatgcagcaggtgctggagttggagatacagctggccaacatcacagtg
ccccaggaccagcggcgcgacgaggagaagatctaccacaagatgagcatttcggagctg
caggctctggcgccctccatggactggcttgagttcctgtctttcttgctgtcaccattg
gagttgagtgactctgagcctgtggtggtgtatgggatggattatttgcagcaggtgtca
gagctcatcaaccgcacggaaccaagcatcctgaacaattacctgatctggaacctggtg
caaaagacaacctcaagcctggaccgacgctttgagtctgcacaagagaagctgctggag
accctctatggcactaagaagtcctgtgtgccgaggtggcagacctgcatctccaacacg
gatgacgcccttggctttgctttggggtccctcttcgtgaaggccacgtttgaccggcaa
agcaaagaaattgcagaggggatgatcagcgaaatccggaccgcatttgaggaggccctg
ggacagctggtttggatggatgagaagacccgccaggcagccaaggagaaagcagatgcc
atctatgatatgattggtttcccagactttatcctggagcccaaagagctggatgatgtt
tatgacgggtacgaaatttctgaagattctttcttccaaaacatgttgaatttgtacaac
ttctctgccaaggttatggctgaccagctccgcaagcctcccagccgagaccagtggagc
atgaccccccagacagtgaatgcctactaccttccaactaagaatgagatcgtcttcccc
gctggcatcctgcaggcccccttctatgcccgcaaccaccccaaggccctgaacttcggt
ggcatcggtgtggtcatgggccatgagttgacgcatgcctttgatgaccaagggcgcgag
tatgacaaagaagggaacctgcggccctggtggcagaatgagtccctggcagccttccgg
aaccacacggcctgcatggaggaacagtacaatcaataccaggtcaatggggagaggctc
aacggccgccagacgctgggggagaacattgctgacaacggggggctgaaggctgcctac
aatgcttacaaagcatggctgagaaagcatggggaggagcagcaactgccagccgtgggg
ctcaccaaccaccagctcttcttcgtgggatttgcccaggtgtggtgctcggtccgcaca
ccagagagctctcacgaggggctggtgaccgacccccacagccctgcccgcttccgcgtg
ctgggcactctctccaactcccgtgacttcctgcggcacttcggctgccctgtcggctcc
cccatgaacccagggcagctgtgtgaggtgtggtag

DBGET integrated database retrieval system