KEGG   Homo sapiens (human): 972Help
Entry
972               CDS       T01001                                 

Gene name
CD74, DHLAG, HLADG, II, Ia-GAMMA, p33
Definition
(RefSeq) CD74 molecule
  KO
K06505  CD74 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa05152  Tuberculosis
hsa05168  Herpes simplex virus 1 infection
Network
nt06129  MHC presentation (viruses)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00590  Antigen processing and presentation by MHC class II molecules
N00591  HSV gB to antigen processing and presentation by MHC class II molecules
Drug target
Milatuzumab: D08944
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    972 (CD74)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    972 (CD74)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    972 (CD74)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    972 (CD74)
   00535 Proteoglycans [BR:hsa00535]
    972 (CD74)
CD molecules [BR:hsa04090]
 Proteins
  972 (CD74)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Others
   972 (CD74)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC2-interact MHCassoc_trimer Thyroglobulin_1
Motif
Other DBs
NCBI-GeneID: 972
NCBI-ProteinID: NP_001020330
OMIM: 142790
HGNC: 1697
Ensembl: ENSG00000019582
Vega: OTTHUMG00000163559
Pharos: P04233(Tchem)
UniProt: P04233
Structure
PDB: 

Position
5q33.1
AA seq 296 aa AA seqDB search
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLL
LAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPM
GALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKV
FESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLP
LQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcacaggaggagaagcaggagctgtcgggaagatcagaagccagtcatggatgaccag
cgcgaccttatctccaacaatgagcaactgcccatgctgggccggcgccctggggccccg
gagagcaagtgcagccgcggagccctgtacacaggcttttccatcctggtgactctgctc
ctcgctggccaggccaccaccgcctacttcctgtaccagcagcagggccggctggacaaa
ctgacagtcacctcccagaacctgcagctggagaacctgcgcatgaagcttcccaagcct
cccaagcctgtgagcaagatgcgcatggccaccccgctgctgatgcaggcgctgcccatg
ggagccctgccccaggggcccatgcagaatgccaccaagtatggcaacatgacagaggac
catgtgatgcacctgctccagaatgctgaccccctgaaggtgtacccgccactgaagggg
agcttcccggagaacctgagacaccttaagaacaccatggagaccatagactggaaggtc
tttgagagctggatgcaccattggctcctgtttgaaatgagcaggcactccttggagcaa
aagcccactgacgctccaccgaaagtactgaccaagtgccaggaagaggtcagccacatc
cctgctgtccacccgggttcattcaggcccaagtgcgacgagaacggcaactatctgcca
ctccagtgctatgggagcatcggctactgctggtgtgtcttccccaacggcacggaggtc
cccaacaccagaagccgcgggcaccataactgcagtgagtcactggaactggaggacccg
tcttctgggctgggtgtgaccaagcaggatctgggcccagtccccatgtga

DBGET integrated database retrieval system