KEGG   Homo sapiens (human): 9721Help
Entry
9721              CDS       T01001                                 

Gene name
GPRIN2, GRIN2, KIAA0514
Definition
(RefSeq) G protein regulated inducer of neurite outgrowth 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: GRIN_C
Motif
Other DBs
NCBI-GeneID: 9721
NCBI-ProteinID: NP_055511
OMIM: 611240
HGNC: 23730
Ensembl: ENSG00000204175
Vega: OTTHUMG00000018107
Pharos: O60269(Tdark)
UniProt: O60269
Position
10q11.22
AA seq 458 aa AA seqDB search
MSSSRPEPGPWAPLSPRLQPLSQSSSSLLGEGREQRPELRKTASSTVWQAQLGEASTRPQ
APEEEGNPPESMKPARASGPKARPSAGGHWWSSTVGNVSTMGGSDLCRLRAPSAAAMQRS
HSDLVRSTQMRGHSGARKASLSCSALGSSPVHRAQLQPGGTSGQGGQAPAGLERDLAPED
ETSNSAWMLGASQLSVPPLDLGDTTAHSSSAQAEPKAAEQLATTTCHALPPAALLCGMRE
VRAGGCCHALPATGILAFPKLVASVSESGLQAQHGVKIHCRLSGGLPGHSHCCAHLWGPA
GLVPEPGSRTKDVWTMTSANDLAPAEASPLSAQDAGVQAAPVAACKAVATSPSLEAPAAL
HVFPEVTLGSSLEEVPSPVRDVRWDAEGMTWEVYGAAVDLEVLGVAIQKHLEMQFEQLQR
APASEDSLSVEGRRGPLRAVMQSLRRPSCCGCSGAAPE
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagctccagccgccccgagccgggtccctgggcacccctgagcccccgccttcagccc
ctgtcccagagctcttccagcctgctgggtgaaggccgggaacagaggccagagctccgc
aagactgccagcagcaccgtgtggcaggcccagctgggcgaggccagcaccagaccccag
gccccggaggaagaggggaacccgcctgagagcatgaagccagcacgggcctctggcccc
aaggcgcgacccagtgctggaggccactggtggagcagcactgtgggcaatgtgtccacc
atgggcggcagtgacctgtgtcgcctgcgggcccctagtgctgctgctatgcagaggagc
cattcagacctggtccgtagcacccagatgcggggacacagtggtgctcggaaggccagt
ctcagctgctcagcccttggcagcagccctgtccacagggctcagctgcagccaggtggt
acttctggccagggtggccaggcccctgcaggcctggaaagggacctggctcctgaggat
gagacttctaactcagcctggatgctgggggcgagtcagttgtcagtgccaccactagac
ctgggggacacaactgcccacagcagcagtgcccaggctgagcccaaagctgctgaacag
ctggctaccaccacctgccatgctctgcccccagctgctctactctgtggcatgagggag
gtgagggctggtggctgctgccatgccctacctgccacagggatcctggcctttcccaaa
ctagtggcgtcagtgagcgagtctgggctgcaggctcagcatggggtgaagatccactgt
aggttgtctggggggctccctgggcattcccattgctgtgcccacctttggggtcccgct
gggttagtcccagagcctggctctaggaccaaagatgtgtggaccatgacctcagccaat
gacttggcccctgcagaggcatccccgctgtcagcccaggatgctggtgtgcaggcggcc
ccagtggcggcctgcaaggctgtggccaccagtccgtccctggaagcgcctgcagccctg
catgtgttcccagaggtaactctggggtccagcctggaggaggtgccgtcccctgtgcgg
gatgtgcgatgggatgctgagggcatgacatgggaggtgtacggagctgcggtggacctg
gaggtgctcggtgtggccatccagaagcacctggagatgcagtttgagcagctgcagcgg
gcgcccgccagcgaggacagcctgtctgtggagggccggagggggccactgcgggctgtc
atgcagtccctgcggcgccccagctgctgcggctgctccggcgcggcccccgagtga

DBGET integrated database retrieval system