KEGG   Homo sapiens (human): 9722Help
Entry
9722              CDS       T01001                                 

Gene name
NOS1AP, 6330408P19Rik, CAPON
Definition
(RefSeq) nitric oxide synthase 1 adaptor protein
  KO
K16513  carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04713  Circadian entrainment
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04713 Circadian entrainment
    9722 (NOS1AP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9722 (NOS1AP)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    9722 (NOS1AP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID
Motif
Other DBs
NCBI-GeneID: 9722
NCBI-ProteinID: NP_055512
OMIM: 605551
HGNC: 16859
Ensembl: ENSG00000198929
Vega: OTTHUMG00000024049
Pharos: O75052(Tbio)
UniProt: O75052
Position
1q23.3
AA seq 506 aa AA seqDB search
MPSKTKYNLVDDGHDLRIPLHNEDAFQHGICFEAKYVGSLDVPRPNSRVEIVAAMRRIRY
EFKAKNIKKKKVSIMVSVDGVKVILKKKKKLLLLQKKEWTWDESKMLVMQDPIYRIFYVS
HDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNA
DGQEDGESERNSNSSGDPGRQLTGAERASTATAEETDIDAVEVPLPGNDVLEFSRGVTDL
DAVGKEGGSHTGSKVSHPQEPMLTASPRMLLPSSSSKPPGLGTETPLSTHHQMQLLQQLL
QQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHISLLVKQVQELE
LKLSGQNAMGSQDSLLEITFRSGALPVLCDPTTPKPEDLHSPPLGAGLADFAHPAGSPLG
RRDCLVKLECFRFLPPEDTPPPAQGEALLGGLELIKFRESGIASEYESNTDESEERDSWS
QEELPRLLNVLQRQELGDGLDDEIAV
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcaaaaccaagtacaaccttgtggacgatgggcacgacctgcggatccccttg
cacaacgaggacgccttccagcacggcatctgctttgaggccaagtacgtaggaagcctg
gacgtgccaaggcccaacagcagggtggagatcgtggctgccatgcgccggatacggtat
gagtttaaagccaagaacatcaagaagaagaaagtgagcattatggtttcagtggatgga
gtgaaagtgattctgaagaagaagaaaaagcttcttttattgcagaaaaaggaatggacg
tgggatgagagcaagatgctggtgatgcaggaccccatctacaggatcttctatgtctct
catgattcccaagacttgaagatcttcagctatatcgctcgagatggtgccagcaatatc
ttcaggtgtaacgtctttaaatccaagaagaagagccaagctatgagaatcgttcggacg
gtggggcaggcctttgaggtctgccacaagctgagcctgcagcacacgcagcagaatgca
gatggccaggaagatggagagagcgagaggaacagcaacagctcaggagacccaggccgc
cagctcactggagccgagagggcctccacggccactgcagaggagactgacatcgatgcg
gtggaggtcccacttccagggaatgatgtcctggaattcagccgaggtgtgactgatcta
gatgctgtagggaaggaaggaggctctcacacaggctccaaggtttcgcacccccaggag
cccatgctgacagcctcacccaggatgctgctcccttcttcttcctcgaagcctccaggc
ctgggcacagagacaccgctgtccactcaccaccagatgcagctcctccagcagctcctc
cagcagcagcagcagcagacacaagtggctgtggcccaggtacacttgctgaaggaccag
ttggctgctgaggctgcggcgcggctggaggcccaggctcgcgtgcatcagcttttgctg
cagaacaaggacatgctccagcacatctccctgctggtcaagcaggtgcaagagctggaa
ctgaagctgtcaggacagaacgccatgggctcccaggacagcttgctggagatcaccttc
cgctccggagccctgcccgtgctctgtgaccccacgacccctaagccagaggacctgcat
tcgccgccgctgggcgcgggcttggctgactttgcccaccctgcgggcagccccttaggt
aggcgcgactgcttggtgaagctggagtgctttcgctttcttccgcccgaggacaccccg
cccccagcgcagggcgaggcgctcctgggcggtctggagctcatcaagttccgagagtca
ggcatcgcctcggagtacgagtccaacacggacgagagcgaggagcgcgactcgtggtcc
caggaggagctgccgcgcctgctgaatgtcctgcagaggcaggaactgggcgacggcctg
gatgatgagatcgccgtgtag

DBGET integrated database retrieval system