KEGG   Homo sapiens (human): 9723Help
Entry
9723              CDS       T01001                                 

Gene name
SEMA3E, M-SEMAH, M-SemaK, SEMAH, coll-5
Definition
(RefSeq) semaphorin 3E
  KO
K06840  semaphorin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Disease
H00556  CHARGE syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    9723 (SEMA3E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sema ig V-set Ig_3 Ig_2 PSI
Motif
Other DBs
NCBI-GeneID: 9723
NCBI-ProteinID: NP_036563
OMIM: 608166
HGNC: 10727
Ensembl: ENSG00000170381
Vega: OTTHUMG00000154693
Pharos: O15041(Tbio)
UniProt: O15041
Position
7q21.11
AA seq 775 aa AA seqDB search
MASAGHIITLLLWGYLLELWTGGHTADTTHPRLRLSHKELLNLNRTSIFHSPFGFLDLHT
MLLDEYQERLFVGGRDLVYSLSLERISDGYKEIHWPSTALKMEECIMKGKDAGECANYVR
VLHHYNRTHLLTCGTGAFDPVCAFIRVGYHLEDPLFHLESPRSERGRGRCPFDPSSSFIS
TLIGSELFAGLYSDYWSRDAAIFRSMGRLAHIRTEHDDERLLKEPKFVGSYMIPDNEDRD
DNKVYFFFTEKALEAENNAHAIYTRVGRLCVNDVGGQRILVNKWSTFLKARLVCSVPGMN
GIDTYFDELEDVFLLPTRDHKNPVIFGLFNTTSNIFRGHAICVYHMSSIRAAFNGPYAHK
EGPEYHWSVYEGKVPYPRPGSCASKVNGGRYGTTKDYPDDAIRFARSHPLMYQAIKPAHK
KPILVKTDGKYNLKQIAVDRVEAEDGQYDVLFIGTDNGIVLKVITIYNQEMESMEEVILE
ELQIFKDPVPIISMEISSKRQQLYIGSASAVAQVRFHHCDMYGSACADCCLARDPYCAWD
GISCSRYYPTGTHAKRRFRRQDVRHGNAAQQCFGQQFVGDALDKTEEHLAYGIENNSTLL
ECTPRSLQAKVIWFVQKGRETRKEEVKTDDRVVKMDLGLLFLRLHKSDAGTYFCQTVEHS
FVHTVRKITLEVVEEEKVEDMFNKDDEEDRHHRMPCPAQSSISQGAKPWYKEFLQLIGYS
NFQRVEEYCEKVWCTDRKRKKLKMSPSKWKYANPQEKKLRSKPEHYRLPRHTLDS
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgcggggcacattatcaccttgctcctgtggggttacttactggagctttgg
acaggaggtcatacagctgatactacccacccccggttacgcctgtcacataaagagctc
ttgaatctgaacagaacatcaatatttcatagcccttttggatttcttgatctccataca
atgctgctggatgaatatcaagagaggctcttcgtgggaggcagggaccttgtatattcc
ctcagcttggagagaatcagtgacggctataaagagatacactggccgagtacagctcta
aaaatggaagaatgcataatgaagggaaaagatgcgggtgaatgtgcaaattatgttcgg
gttttgcatcactataacaggacacaccttctgacctgtggtactggagcttttgatcca
gtttgtgccttcatcagagttggatatcatttggaggatcctctgtttcacctggaatca
cccagatctgagagaggaaggggcagatgtccttttgaccccagctcctccttcatctcc
actttaattggtagtgaattgtttgctggactctacagtgactactggagcagagacgct
gcgatcttccgcagcatggggcgactggcccatatccgcactgagcatgacgatgagcgt
ctgttgaaagaaccaaaatttgtaggttcatacatgattcctgacaatgaagacagagat
gacaacaaagtatatttcttttttactgagaaggcactggaggcagaaaacaatgctcac
gcaatttacaccagggtcgggcgactctgtgtgaatgatgtaggagggcagagaatactg
gtgaataagtggagcactttcctaaaagcgagactcgtttgctcagtaccaggaatgaat
ggaattgacacatattttgatgaattagaggacgtttttttgctacctaccagagatcat
aagaatccagtgatatttggactctttaacactaccagtaatatttttcgagggcatgct
atatgtgtctatcacatgtctagcattcgggcagccttcaacggaccatatgcacataag
gaaggacctgaataccactggtcagtctatgaaggaaaagtcccttatccaaggcctggt
tcttgtgccagcaaagtaaatggagggagatacggaaccaccaaggactatcctgatgat
gccatccgatttgcaagaagtcatccactaatgtaccaggccataaaacctgcccataaa
aaaccaatattggtaaaaacagatggaaaatataacctgaaacaaatagcagtagatcga
gtggaagctgaggatggccaatatgacgtcttgtttattgggacagataatggaattgtg
ctgaaagtaatcacaatttacaaccaagaaatggaatcaatggaagaagtaattctagaa
gaacttcagatattcaaggatccagttcctattatttctatggagatttcttcaaagcgg
caacagctgtatattggatctgcttctgctgtggctcaagtcagattccatcactgtgac
atgtatggaagtgcttgtgctgactgctgcctggctcgagacccttactgtgcctgggat
ggcatatcctgctcccggtattacccaacaggcacacatgcaaaaaggcgtttccggaga
caagatgttcgacatggaaatgcagctcagcagtgctttggacaacagtttgttggggat
gctttggataagactgaagaacatctggcttatggcatagagaacaacagtactttgctg
gaatgtaccccacgatctttacaagcgaaagttatctggtttgtacagaaaggacgtgag
acaagaaaagaggaggtgaagacagatgacagagtggttaagatggaccttggtttactc
ttcctaaggttacacaaatcagatgctgggacctatttttgccagacagtagagcatagc
tttgtccatacggtccgtaaaatcaccttggaggtagtggaagaggagaaagtcgaggat
atgtttaacaaggacgatgaggaggacaggcatcacaggatgccttgtcctgctcagagt
agcatctcgcagggagcaaaaccatggtacaaggaattcttgcagctgatcggttatagc
aacttccagagagtggaagaatactgcgagaaagtatggtgcacagatagaaagaggaaa
aagcttaaaatgtcaccctccaagtggaagtatgccaaccctcaggaaaagaagctccgt
tccaaacctgagcattaccgcctgcccaggcacacgctggactcctga

DBGET integrated database retrieval system