KEGG   Homo sapiens (human): 9723
Entry
9723              CDS       T01001                                 
Symbol
SEMA3E, M-SEMAH, M-SemaK, SEMAH, coll-5
Name
(RefSeq) semaphorin 3E
  KO
K06840  semaphorin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Disease
H00556  CHARGE syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    9723 (SEMA3E)
SSDB
Motif
Pfam: Sema ig Ig_6 V-set Ig_3 PSI
Other DBs
NCBI-GeneID: 9723
NCBI-ProteinID: NP_036563
OMIM: 608166
HGNC: 10727
Ensembl: ENSG00000170381
Pharos: O15041(Tbio)
UniProt: O15041
Position
7:complement(83363238..83649139)
AA seq 775 aa
MASAGHIITLLLWGYLLELWTGGHTADTTHPRLRLSHKELLNLNRTSIFHSPFGFLDLHT
MLLDEYQERLFVGGRDLVYSLSLERISDGYKEIHWPSTALKMEECIMKGKDAGECANYVR
VLHHYNRTHLLTCGTGAFDPVCAFIRVGYHLEDPLFHLESPRSERGRGRCPFDPSSSFIS
TLIGSELFAGLYSDYWSRDAAIFRSMGRLAHIRTEHDDERLLKEPKFVGSYMIPDNEDRD
DNKVYFFFTEKALEAENNAHAIYTRVGRLCVNDVGGQRILVNKWSTFLKARLVCSVPGMN
GIDTYFDELEDVFLLPTRDHKNPVIFGLFNTTSNIFRGHAICVYHMSSIRAAFNGPYAHK
EGPEYHWSVYEGKVPYPRPGSCASKVNGGRYGTTKDYPDDAIRFARSHPLMYQAIKPAHK
KPILVKTDGKYNLKQIAVDRVEAEDGQYDVLFIGTDNGIVLKVITIYNQEMESMEEVILE
ELQIFKDPVPIISMEISSKRQQLYIGSASAVAQVRFHHCDMYGSACADCCLARDPYCAWD
GISCSRYYPTGTHAKRRFRRQDVRHGNAAQQCFGQQFVGDALDKTEEHLAYGIENNSTLL
ECTPRSLQAKVIWFVQKGRETRKEEVKTDDRVVKMDLGLLFLRLHKSDAGTYFCQTVEHS
FVHTVRKITLEVVEEEKVEDMFNKDDEEDRHHRMPCPAQSSISQGAKPWYKEFLQLIGYS
NFQRVEEYCEKVWCTDRKRKKLKMSPSKWKYANPQEKKLRSKPEHYRLPRHTLDS
NT seq 2328 nt   +upstreamnt  +downstreamnt
atggcatccgcggggcacattatcaccttgctcctgtggggttacttactggagctttgg
acaggaggtcatacagctgatactacccacccccggttacgcctgtcacataaagagctc
ttgaatctgaacagaacatcaatatttcatagcccttttggatttcttgatctccataca
atgctgctggatgaatatcaagagaggctcttcgtgggaggcagggaccttgtatattcc
ctcagcttggagagaatcagtgacggctataaagagatacactggccgagtacagctcta
aaaatggaagaatgcataatgaagggaaaagatgcgggtgaatgtgcaaattatgttcgg
gttttgcatcactataacaggacacaccttctgacctgtggtactggagcttttgatcca
gtttgtgccttcatcagagttggatatcatttggaggatcctctgtttcacctggaatca
cccagatctgagagaggaaggggcagatgtccttttgaccccagctcctccttcatctcc
actttaattggtagtgaattgtttgctggactctacagtgactactggagcagagacgct
gcgatcttccgcagcatggggcgactggcccatatccgcactgagcatgacgatgagcgt
ctgttgaaagaaccaaaatttgtaggttcatacatgattcctgacaatgaagacagagat
gacaacaaagtatatttcttttttactgagaaggcactggaggcagaaaacaatgctcac
gcaatttacaccagggtcgggcgactctgtgtgaatgatgtaggagggcagagaatactg
gtgaataagtggagcactttcctaaaagcgagactcgtttgctcagtaccaggaatgaat
ggaattgacacatattttgatgaattagaggacgtttttttgctacctaccagagatcat
aagaatccagtgatatttggactctttaacactaccagtaatatttttcgagggcatgct
atatgtgtctatcacatgtctagcattcgggcagccttcaacggaccatatgcacataag
gaaggacctgaataccactggtcagtctatgaaggaaaagtcccttatccaaggcctggt
tcttgtgccagcaaagtaaatggagggagatacggaaccaccaaggactatcctgatgat
gccatccgatttgcaagaagtcatccactaatgtaccaggccataaaacctgcccataaa
aaaccaatattggtaaaaacagatggaaaatataacctgaaacaaatagcagtagatcga
gtggaagctgaggatggccaatatgacgtcttgtttattgggacagataatggaattgtg
ctgaaagtaatcacaatttacaaccaagaaatggaatcaatggaagaagtaattctagaa
gaacttcagatattcaaggatccagttcctattatttctatggagatttcttcaaagcgg
caacagctgtatattggatctgcttctgctgtggctcaagtcagattccatcactgtgac
atgtatggaagtgcttgtgctgactgctgcctggctcgagacccttactgtgcctgggat
ggcatatcctgctcccggtattacccaacaggcacacatgcaaaaaggcgtttccggaga
caagatgttcgacatggaaatgcagctcagcagtgctttggacaacagtttgttggggat
gctttggataagactgaagaacatctggcttatggcatagagaacaacagtactttgctg
gaatgtaccccacgatctttacaagcgaaagttatctggtttgtacagaaaggacgtgag
acaagaaaagaggaggtgaagacagatgacagagtggttaagatggaccttggtttactc
ttcctaaggttacacaaatcagatgctgggacctatttttgccagacagtagagcatagc
tttgtccatacggtccgtaaaatcaccttggaggtagtggaagaggagaaagtcgaggat
atgtttaacaaggacgatgaggaggacaggcatcacaggatgccttgtcctgctcagagt
agcatctcgcagggagcaaaaccatggtacaaggaattcttgcagctgatcggttatagc
aacttccagagagtggaagaatactgcgagaaagtatggtgcacagatagaaagaggaaa
aagcttaaaatgtcaccctccaagtggaagtatgccaaccctcaggaaaagaagctccgt
tccaaacctgagcattaccgcctgcccaggcacacgctggactcctga

DBGET integrated database retrieval system