KEGG   Homo sapiens (human): 9725Help
Entry
9725              CDS       T01001                                 

Gene name
TMEM63A, KIAA0792
Definition
(RefSeq) transmembrane protein 63A
  KO
K21989  calcium permeable stress-gated cation channel
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9725 (TMEM63A)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   9725 (TMEM63A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RSN1_7TM PHM7_cyt RSN1_TM RRM_1
Motif
Other DBs
NCBI-GeneID: 9725
NCBI-ProteinID: NP_055513
HGNC: 29118
Ensembl: ENSG00000196187
Vega: OTTHUMG00000037442
Pharos: O94886(Tdark)
UniProt: O94886 A0A024R3T3
Position
1q42.12
AA seq 807 aa AA seqDB search
MMDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIPTVLLIDVSC
FLFLILVFSIIRRRFWDYGRIALVSEADSESRFQRLSSTSSSGQQDFENELGCCPWLTAI
FRLHDDQILEWCGEDAIHYLSFQRHIIFLLVVVSFLSLCVILPVNLSGDLLDKDPYSFGR
TTIANLQTDNDLLWLHTIFAVIYLFLTVGFMRHHTQSIKYKEENLVRRTLFITGLPRDAR
KETVESHFRDAYPTCEVVDVQLCYNVAKLIYLCKEKKKTEKSLTYYTNLQVKTGQRTLIN
PKPCGQFCCCEVLGCEWEDAISYYTRMKDRLLERITEEERHVQDQPLGMAFVTFQEKSMA
TYILKDFNACKCQSLQCKGEPQPSSHSRELYTSKWTVTFAADPEDICWKNLSIQGLRWWL
QWLGINFTLFLGLFFLTTPSIILSTMDKFNVTKPIHALNNPIISQFFPTLLLWSFSALLP
SIVYYSTLLESHWTKSGENQIMMTKVYIFLIFMVLILPSLGLTSLDFFFRWLFDKTSSEA
SIRLECVFLPDQGAFFVNYVIASAFIGNGMELLRLPGLILYTFRMIMAKTAADRRNVKQN
QAFQYEFGAMYAWMLCVFTVIVAYSITCPIIAPFGLIYILLKHMVDRHNLYFVYLPAKLE
KGIHFAAVNQALAAPILCLFWLYFFSFLRLGMKAPATLFTFLVLLLTILVCLAHTCFGCF
KHLSPLNYKTEEPASDKGSEAEAHMPPPFTPYVPRILNGLASERTALSPQQQQQQTYGAI
HNISGTIPGQCLAQSATGSVAAAPQEA
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgatggactccccgttcctggagctgtggcagtccaaggcagtgtccatcagggagcag
ctgggactcggggaccggcccaacgactcctattgctacaactcggccaaaaacagcacc
gtgctccagggggtcacctttggtggcatccccactgtcctgctcatagacgtcagctgc
ttcctgttcttaatcttggtgttttctattataagaagaagattctgggactatggccgc
attgccctggtgtcagaagcagacagcgagtccagatttcagagattgtcatcgacttcc
tcctcaggtcaacaagactttgaaaatgagctgggatgctgtccctggctgactgccatc
ttccgtctgcatgatgaccagatcctggaatggtgtggggaggacgccatccactacctg
tccttccagaggcacatcatcttcctgttggtggtggtcagctttttgtccctgtgtgtc
atcctgcctgtcaacctctcaggggacttgctggacaaagacccgtatagttttgggagg
acaacaatagcaaacctacagactgacaatgacctcctttggctgcacaccatctttgct
gtcatttacctcttcctcactgtgggtttcatgcggcaccacactcagtccattaagtac
aaagaggagaacctggtgaggcggaccctgttcatcacaggactccccagagatgccagg
aaggagactgtggagagccacttccgggacgcgtatcccacgtgtgaggtggttgatgtg
cagctgtgctacaacgtggccaaactgatctacctgtgcaaggagaaaaagaagactgag
aagagcctgacctattacacaaacctgcaggtgaagacaggccagcggaccctcatcaac
cccaagccctgtggccagttttgctgctgtgaagtgctgggctgtgagtgggaagacgcc
atctcttactacacacggatgaaggacaggctgctggagaggatcacagaggaagaacgc
cacgtccaggaccagcccctgggaatggccttcgtcaccttccaggagaagtccatggcc
acctacatcctgaaagatttcaatgcctgcaagtgtcagagccttcagtgcaaaggtgag
ccccagccgtcctcccatagcagggagctctatacctccaagtggacagtcacctttgct
gctgaccctgaggacatctgctggaagaacctctctatccagggcctccgctggtggcta
cagtggctgggcatcaacttcaccctcttcctggggctatttttcctgaccacaccctcc
atcatcctgtccaccatggacaagtttaatgtcaccaaacccatccatgcgctgaataac
ccgatcatcagccagttcttccccaccctcctgctctggtccttctcggccctgctcccc
tccattgtctactactctacactgctggagtctcactggaccaagtcgggggaaaaccag
atcatgatgaccaaagtctacatattcttgatcttcatggtgctgatcctgccctccctg
ggtctcaccagtctagattttttcttccggtggctctttgacaaaacttcctcggaggcc
tccatcaggttggagtgcgtcttcctgcctgaccagggtgccttctttgtgaactatgtc
atcgcctcggccttcatcggcaatggcatggagctgctgcggctgccaggtctcatcctc
tataccttccgcatgatcatggccaagacggctgctgaccgcaggaatgtcaagcagaac
caggccttccagtacgagtttggagccatgtatgcatggatgctgtgtgtcttcactgtc
atcgtggcctacagcatcacttgtcccatcatcgcgccatttggcctcatctacatcctg
ctcaagcacatggtggaccggcacaacctctacttcgtctacctcccagccaagctggag
aaggggatccactttgccgctgtgaaccaggccttggcagcccccatcctgtgcctcttc
tggctctacttcttttccttcctgcgcctgggtatgaaggcccccgccactctgttcacc
ttcctggtgctgctgctcaccatcctggtctgcctggctcacacctgctttggatgcttc
aagcacctcagccctctgaactacaaaacagaagagcctgcaagtgacaaaggaagtgag
gcagaggcccacatgcccccaccgttcacaccctacgtgcctcggattctgaacggcttg
gcctcggagaggacagcactgtctccgcagcagcagcagcagcagacctatggtgccatc
cacaacatcagcgggactatccctggacagtgcttggcgcagagcgccacgggcagtgtg
gctgctgccccccaggaggcctga

DBGET integrated database retrieval system