KEGG   Homo sapiens (human): 9727
Entry
9727              CDS       T01001                                 
Symbol
RAB11FIP3, CART1, FIP3-Rab11, Rab11-FIP3
Name
(RefSeq) RAB11 family interacting protein 3
  KO
K12485  Rab11 family-interacting protein 3/4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9727 (RAB11FIP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9727 (RAB11FIP3)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    9727 (RAB11FIP3)
SSDB
Motif
Pfam: RBD-FIP EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_1 WD40_alt ZapB EF-hand_5 Crescentin EF-hand_9
Other DBs
NCBI-GeneID: 9727
NCBI-ProteinID: NP_055515
OMIM: 608738
HGNC: 17224
Ensembl: ENSG00000090565
Pharos: O75154(Tbio)
UniProt: O75154
Structure
Position
16:425649..523011
AA seq 756 aa
MASAPPASPPGSEPPGPDPEPGGPDGPGAAQLAPGPAELRLGAPVGGPDPQSPGLDEPAP
GAAADGGARWSAGPAPGLEGGPRDPGPSAPPPRSGPRGQLASPDAPGPGPRSEAPLPELD
PLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGS
PPQPSDLSQTHPLPSEPVGSQEDGPRLRAVFDALDGDGDGFVRIEDFIQFATVYGAEQVK
DLTKYLDPSGLGVISFEDFYQGITAIRNGDPDGQCYGGVASAQDEEPLACPDEFDDFVTY
EANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEGDADSAGGSAVPSECLDAMEE
PDHGALLLLPGRPHPHGQSVITVIGGEEHFEDYGEGSEAELSPETLCNGQLGCSDPAFLT
PSPTKRLSSKKVARYLHQSGALTMEALEDPSPELMEGPEEDIADKVVFLERRVLELEKDT
AATGEQHSRLRQENLQLVHRANALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIE
IENLQTRLQQLDEENSELRSCTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRM
GDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLKLEAEQRRGRSSSMGLQEYHSRARE
SELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLFSTAFSESLAAEISSVSRDEL
MEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEVK
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggcgtcggccccgccggcctcgcccccgggctcggagccgccggggcccgacccggag
ccgggcgggccggacgggccgggggcggcacaactggctccgggccctgcggagctacgc
ctcggagcgcccgtcggcggccccgacccgcagtccccgggcctggatgagcctgcgccc
ggggccgctgcagatggcggggcgcgttggagcgccgggccggccccggggctggaggga
ggcccgcgagaccccgggccgtccgccccgccgccgcgctccggcccgcgggggcagctt
gcgagccccgacgccccgggcccagggccgcgctccgaagcgccgcttccagaactcgac
ccgttgttctcctggactgaggagcccgaggagtgtggccccgcgagctgcccggagagc
gcgcctttccgcttgcaggggtccagcagcagccaccgagcgcggggcgaggtcgacgtc
ttctctcccttccccgcgcccacggcgggcgagctggcgctggagcaaggtcccgggtcc
ccgccgcagccctcggacctcagccagacccacccccttccgagcgagcccgtggggagt
caggaggacggcccccgcctccgagccgtgttcgatgccctggacggggatggggacggt
ttcgtccgcatcgaggacttcatccagtttgctacggtctacggggcagagcaggtgaag
gacttaactaagtacttggatcccagtgggctcggcgtgatcagctttgaagacttctac
caagggatcacagccatcagaaacggagatcctgatggccagtgctacggtggtgtcgct
tctgcccaagatgaggagcccctggcctgcccggacgagttcgatgacttcgtcacctat
gaggccaacgaggtgacggacagcgcgtacatgggctccgagagcacctacagtgagtgt
gagaccttcacggacgaggacaccagcaccctggtgcaccctgagctgcaacctgaaggg
gacgcagacagtgccggcggctcggccgtgccctctgagtgcctggacgccatggaggag
cccgaccatggtgccctgctgctgctcccaggcaggcctcacccccatggccagtctgtc
atcacggtgatcgggggcgaggagcactttgaggactacggtgaaggcagtgaggcggag
ctgtccccagagaccctatgcaacgggcagctgggctgcagtgaccccgctttcctcacg
cccagtccgacaaagcggctctccagcaagaaggtggcaaggtacctgcaccagtcaggg
gccctgaccatggaggccctggaggacccttcccccgagctcatggagggcccagaggag
gacattgctgacaaggttgtcttcctggaaaggcgtgtgctggagctggaaaaggacacg
gcagccaccggtgagcaacacagccgcctgaggcaggagaacctgcagctggtgcacaga
gcaaacgccctggaggagcagctgaaggagcaggagctgagagcctgcgagatggtcctg
gaagagacccggcgtcagaaggagctcctgtgcaagatggagagggagaagagcattgag
atcgagaacctgcagaccaggctacagcaactggacgaggagaacagtgaactccggtcc
tgcacgccctgtctgaaggccaacattgagcgtctggaggaggagaagcagaagctgttg
gatgagatagagtcgctgacgctgcggctcagtgaagagcaggagaacaagaggagaatg
ggggacaggctgagtcacgagaggcaccagttccagagggacaaggaggccacccaggag
ctgatcgaggacctccgaaagcagctggagcacctgcagctcctcaagctggaggccgag
cagcggcggggccgcagcagcagcatgggcctgcaggagtaccacagccgcgcccgggag
agcgagctggagcaggaggtccgcaggctgaagcaggacaaccgcaacctgaaggagcag
aacgaggagctgaacgggcagatcattaccctcagcatccagggcgccaagagcctcttc
tccacagccttctctgagtccctggctgcagagatcagctccgtctcccgagatgagctc
atggaggcgattcagaagcaggaggagatcaacttccgcctgcaggactacatcgacagg
atcatcgtggccatcatggagaccaacccgtccatcctggaggtcaagtag

DBGET integrated database retrieval system