KEGG   Homo sapiens (human): 9734Help
Entry
9734              CDS       T01001                                 

Gene name
HDAC9, HD7, HD7b, HD9, HDAC, HDAC7, HDAC7B, HDAC9B, HDAC9FL, HDRP, MITR
Definition
(RefSeq) histone deacetylase 9
  KO
K11409  histone deacetylase 9 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
Network
N00375  HPV E7 to TNF-IRF1 signaling pathway
Drug target
Belinostat: D08870
Entinostat: D09338
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Tucidinostat: D10993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    9734 (HDAC9)
  09164 Substance dependence
   05034 Alcoholism
    9734 (HDAC9)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    9734 (HDAC9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9734 (HDAC9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     9734 (HDAC9)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     9734 (HDAC9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 9734
NCBI-ProteinID: NP_478056
OMIM: 606543
HGNC: 14065
Ensembl: ENSG00000048052
Vega: OTTHUMG00000152487
Pharos: Q9UKV0(Tclin)
UniProt: Q9UKV0
Position
7p21.1
AA seq 1011 aa AA seqDB search
MHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQ
KQLLIAEFQKQHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQKLEQQRQEQEVERHRR
EQQLPPLRGKDRGRERAVASTEVKQKLQEFLLSKSATKDTPTNGKNHSVSRHPKLWYTAA
HHTSLDQSSPPLSGTSPSYKYTLPGAQDAKDDFPLRKTASEPNLKVRSRLKQKVAERRSS
PLLRRKDGNVVTSFKKRMFEVTESSVSSSSPGSGPSSPNNGPTGSVTENETSVLPPTPHA
EQMVSQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSQLNASNSLKEKQKCETQTLRQ
GVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHP
QSPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQ
QIHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLG
QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQPFLEPTHTRALSVRQAPLAAVGMDGL
EKHRLVSRTHSSPAASVLPHPAMDRPLQPGSATGIAYDPLMLKHQCVCGNSTTHPEHAGR
IQSIWSRLQETGLLNKCERIQGRKASLEEIQLVHSEHHSLLYGTNPLDGQKLDPRILLGD
DSQKFFSSLPCGGLGVDSDTIWNELHSSGAARMAVGCVIELASKVASGELKNGFAVVRPP
GHHAEESTAMGFCFFNSVAITAKYLRDQLNISKILIVDLDVHHGNGTQQAFYADPSILYI
SLHRYDEGNFFPGSGAPNEVGTGLGEGYNINIAWTGGLDPPMGDVEYLEAFRTIVKPVAK
EFDPDMVLVSAGFDALEGHTPPLGGYKVTAKCFGHLTKQLMTLADGRVVLALEGGHDLTA
ICDASEACVNALLGNELEPLAEDILHQSPNMNAVISLQKIIEIQSMSLKFS
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgcacagtatgatcagctcagtggatgtgaagtcagaagttcctgtgggcctggagccc
atctcacctttagacctaaggacagacctcaggatgatgatgcccgtggtggaccctgtt
gtccgtgagaagcaattgcagcaggaattacttcttatccagcagcagcaacaaatccag
aagcagcttctgatagcagagtttcagaaacagcatgagaacttgacacggcagcaccag
gctcagcttcaggagcatatcaaggaacttctagccataaaacagcaacaagaactccta
gaaaaggagcagaaactggagcagcagaggcaagaacaggaagtagagaggcatcgcaga
gaacagcagcttcctcctctcagaggcaaagatagaggacgagaaagggcagtggcaagt
acagaagtaaagcagaagcttcaagagttcctactgagtaaatcagcaacgaaagacact
ccaactaatggaaaaaatcattccgtgagccgccatcccaagctctggtacacggctgcc
caccacacatcattggatcaaagctctccaccccttagtggaacatctccatcctacaag
tacacattaccaggagcacaagatgcaaaggatgatttcccccttcgaaaaactgcctct
gagcccaacttgaaggtgcggtccaggttaaaacagaaagtggcagagaggagaagcagc
cccttactcaggcggaaggatggaaatgttgtcacttcattcaagaagcgaatgtttgag
gtgacagaatcctcagtcagtagcagttctccaggctctggtcccagttcaccaaacaat
gggccaactggaagtgttactgaaaatgagacttcggttttgccccctacccctcatgcc
gagcaaatggtttcacagcaacgcattctaattcatgaagattccatgaacctgctaagt
ctttatacctctccttctttgcccaacattaccttggggcttcccgcagtgccatcccag
ctcaatgcttcgaattcactcaaagaaaagcagaagtgtgagacgcagacgcttaggcaa
ggtgttcctctgcctgggcagtatggaggcagcatcccggcatcttccagccaccctcat
gttactttagagggaaagccacccaacagcagccaccaggctctcctgcagcatttatta
ttgaaagaacaaatgcgacagcaaaagcttcttgtagctggtggagttcccttacatcct
cagtctcccttggcaacaaaagagagaatttcacctggcattagaggtacccacaaattg
ccccgtcacagacccctgaaccgaacccagtctgcacctttgcctcagagcacgttggct
cagctggtcattcaacagcaacaccagcaattcttggagaagcagaagcaataccagcag
cagatccacatgaacaaactgctttcgaaatctattgaacaactgaagcaaccaggcagt
caccttgaggaagcagaggaagagcttcagggggaccaggcgatgcaggaagacagagcg
ccctctagtggcaacagcactaggagcgacagcagtgcttgtgtggatgacacactggga
caagttggggctgtgaaggtcaaggaggaaccagtggacagtgatgaagatgctcagatc
caggaaatggaatctggggagcaggctgcttttatgcaacagcctttcctggaacccacg
cacacacgtgcgctctctgtgcgccaagctccgctggctgcggttggcatggatggatta
gagaaacaccgtctcgtctccaggactcactcttcccctgctgcctctgttttacctcac
ccagcaatggaccgccccctccagcctggctctgcaactggaattgcctatgaccccttg
atgctgaaacaccagtgcgtttgtggcaattccaccacccaccctgagcatgctggacga
atacagagtatctggtcacgactgcaagaaactgggctgctaaataaatgtgagcgaatt
caaggtcgaaaagccagcctggaggaaatacagcttgttcattctgaacatcactcactg
ttgtatggcaccaaccccctggacggacagaagctggaccccaggatactcctaggtgat
gactctcaaaagtttttttcctcattaccttgtggtggacttggggtggacagtgacacc
atttggaatgagctacactcgtccggtgctgcacgcatggctgttggctgtgtcatcgag
ctggcttccaaagtggcctcaggagagctgaagaatgggtttgctgttgtgaggccccct
ggccatcacgctgaagaatccacagccatggggttctgcttttttaattcagttgcaatt
accgccaaatacttgagagaccaactaaatataagcaagatattgattgtagatctggat
gttcaccatggaaacggtacccagcaggccttttatgctgaccccagcatcctgtacatt
tcactccatcgctatgatgaagggaactttttccctggcagtggagccccaaatgaggtt
ggaacaggccttggagaagggtacaatataaatattgcctggacaggtggccttgatcct
cccatgggagatgttgagtaccttgaagcattcaggaccatcgtgaagcctgtggccaaa
gagtttgatccagacatggtcttagtatctgctggatttgatgcattggaaggccacacc
cctcctctaggagggtacaaagtgacggcaaaatgttttggtcatttgacgaagcaattg
atgacattggctgatggacgtgtggtgttggctctagaaggaggacatgatctcacagcc
atctgtgatgcatcagaagcctgtgtaaatgcccttctaggaaatgagctggagccactt
gcagaagatattctccaccaaagcccgaatatgaatgctgttatttctttacagaagatc
attgaaattcaaagtatgtctttaaagttctcttaa

DBGET integrated database retrieval system