KEGG   Homo sapiens (human): 9734Help
Entry
9734              CDS       T01001                                 

Gene name
HDAC9, HD7, HD7b, HD9, HDAC, HDAC7, HDAC7B, HDAC9B, HDAC9FL, HDRP, MITR
Definition
(RefSeq) histone deacetylase 9
  KO
K11409  histone deacetylase 9 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
Network
N00375  HPV E7 to TNF-IRF1 signaling pathway
Drug target
Belinostat: D08870
Entinostat: D09338
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Tucidinostat: D10993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    9734 (HDAC9)
  09165 Substance dependence
   05034 Alcoholism
    9734 (HDAC9)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    9734 (HDAC9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9734 (HDAC9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     9734 (HDAC9)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     9734 (HDAC9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 9734
NCBI-ProteinID: NP_478056
OMIM: 606543
HGNC: 14065
Ensembl: ENSG00000048052
Vega: OTTHUMG00000152487
Pharos: Q9UKV0(Tclin)
UniProt: Q9UKV0
Position
7p21.1
AA seq 1011 aa AA seqDB search
MHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQ
KQLLIAEFQKQHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQKLEQQRQEQEVERHRR
EQQLPPLRGKDRGRERAVASTEVKQKLQEFLLSKSATKDTPTNGKNHSVSRHPKLWYTAA
HHTSLDQSSPPLSGTSPSYKYTLPGAQDAKDDFPLRKTASEPNLKVRSRLKQKVAERRSS
PLLRRKDGNVVTSFKKRMFEVTESSVSSSSPGSGPSSPNNGPTGSVTENETSVLPPTPHA
EQMVSQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSQLNASNSLKEKQKCETQTLRQ
GVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHP
QSPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQ
QIHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLG
QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQPFLEPTHTRALSVRQAPLAAVGMDGL
EKHRLVSRTHSSPAASVLPHPAMDRPLQPGSATGIAYDPLMLKHQCVCGNSTTHPEHAGR
IQSIWSRLQETGLLNKCERIQGRKASLEEIQLVHSEHHSLLYGTNPLDGQKLDPRILLGD
DSQKFFSSLPCGGLGVDSDTIWNELHSSGAARMAVGCVIELASKVASGELKNGFAVVRPP
GHHAEESTAMGFCFFNSVAITAKYLRDQLNISKILIVDLDVHHGNGTQQAFYADPSILYI
SLHRYDEGNFFPGSGAPNEVGTGLGEGYNINIAWTGGLDPPMGDVEYLEAFRTIVKPVAK
EFDPDMVLVSAGFDALEGHTPPLGGYKVTAKCFGHLTKQLMTLADGRVVLALEGGHDLTA
ICDASEACVNALLGNELEPLAEDILHQSPNMNAVISLQKIIEIQSMSLKFS
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgcacagtatgatcagctcagtggatgtgaagtcagaagttcctgtgggcctggagccc
atctcacctttagacctaaggacagacctcaggatgatgatgcccgtggtggaccctgtt
gtccgtgagaagcaattgcagcaggaattacttcttatccagcagcagcaacaaatccag
aagcagcttctgatagcagagtttcagaaacagcatgagaacttgacacggcagcaccag
gctcagcttcaggagcatatcaaggaacttctagccataaaacagcaacaagaactccta
gaaaaggagcagaaactggagcagcagaggcaagaacaggaagtagagaggcatcgcaga
gaacagcagcttcctcctctcagaggcaaagatagaggacgagaaagggcagtggcaagt
acagaagtaaagcagaagcttcaagagttcctactgagtaaatcagcaacgaaagacact
ccaactaatggaaaaaatcattccgtgagccgccatcccaagctctggtacacggctgcc
caccacacatcattggatcaaagctctccaccccttagtggaacatctccatcctacaag
tacacattaccaggagcacaagatgcaaaggatgatttcccccttcgaaaaactgcctct
gagcccaacttgaaggtgcggtccaggttaaaacagaaagtggcagagaggagaagcagc
cccttactcaggcggaaggatggaaatgttgtcacttcattcaagaagcgaatgtttgag
gtgacagaatcctcagtcagtagcagttctccaggctctggtcccagttcaccaaacaat
gggccaactggaagtgttactgaaaatgagacttcggttttgccccctacccctcatgcc
gagcaaatggtttcacagcaacgcattctaattcatgaagattccatgaacctgctaagt
ctttatacctctccttctttgcccaacattaccttggggcttcccgcagtgccatcccag
ctcaatgcttcgaattcactcaaagaaaagcagaagtgtgagacgcagacgcttaggcaa
ggtgttcctctgcctgggcagtatggaggcagcatcccggcatcttccagccaccctcat
gttactttagagggaaagccacccaacagcagccaccaggctctcctgcagcatttatta
ttgaaagaacaaatgcgacagcaaaagcttcttgtagctggtggagttcccttacatcct
cagtctcccttggcaacaaaagagagaatttcacctggcattagaggtacccacaaattg
ccccgtcacagacccctgaaccgaacccagtctgcacctttgcctcagagcacgttggct
cagctggtcattcaacagcaacaccagcaattcttggagaagcagaagcaataccagcag
cagatccacatgaacaaactgctttcgaaatctattgaacaactgaagcaaccaggcagt
caccttgaggaagcagaggaagagcttcagggggaccaggcgatgcaggaagacagagcg
ccctctagtggcaacagcactaggagcgacagcagtgcttgtgtggatgacacactggga
caagttggggctgtgaaggtcaaggaggaaccagtggacagtgatgaagatgctcagatc
caggaaatggaatctggggagcaggctgcttttatgcaacagcctttcctggaacccacg
cacacacgtgcgctctctgtgcgccaagctccgctggctgcggttggcatggatggatta
gagaaacaccgtctcgtctccaggactcactcttcccctgctgcctctgttttacctcac
ccagcaatggaccgccccctccagcctggctctgcaactggaattgcctatgaccccttg
atgctgaaacaccagtgcgtttgtggcaattccaccacccaccctgagcatgctggacga
atacagagtatctggtcacgactgcaagaaactgggctgctaaataaatgtgagcgaatt
caaggtcgaaaagccagcctggaggaaatacagcttgttcattctgaacatcactcactg
ttgtatggcaccaaccccctggacggacagaagctggaccccaggatactcctaggtgat
gactctcaaaagtttttttcctcattaccttgtggtggacttggggtggacagtgacacc
atttggaatgagctacactcgtccggtgctgcacgcatggctgttggctgtgtcatcgag
ctggcttccaaagtggcctcaggagagctgaagaatgggtttgctgttgtgaggccccct
ggccatcacgctgaagaatccacagccatggggttctgcttttttaattcagttgcaatt
accgccaaatacttgagagaccaactaaatataagcaagatattgattgtagatctggat
gttcaccatggaaacggtacccagcaggccttttatgctgaccccagcatcctgtacatt
tcactccatcgctatgatgaagggaactttttccctggcagtggagccccaaatgaggtt
ggaacaggccttggagaagggtacaatataaatattgcctggacaggtggccttgatcct
cccatgggagatgttgagtaccttgaagcattcaggaccatcgtgaagcctgtggccaaa
gagtttgatccagacatggtcttagtatctgctggatttgatgcattggaaggccacacc
cctcctctaggagggtacaaagtgacggcaaaatgttttggtcatttgacgaagcaattg
atgacattggctgatggacgtgtggtgttggctctagaaggaggacatgatctcacagcc
atctgtgatgcatcagaagcctgtgtaaatgcccttctaggaaatgagctggagccactt
gcagaagatattctccaccaaagcccgaatatgaatgctgttatttctttacagaagatc
attgaaattcaaagtatgtctttaaagttctcttaa

DBGET integrated database retrieval system