KEGG   Homo sapiens (human): 9738Help
Entry
9738              CDS       T01001                                 

Gene name
CCP110, CP110, Cep110
Definition
(RefSeq) centriolar coiled-coil protein 110
  KO
K16453  centrosomal protein CEP110
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9738 (CCP110)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    9738 (CCP110)
   Centrosome duplication proteins
    Centriole replication proteins
     9738 (CCP110)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CALM_bind
Motif
Other DBs
NCBI-GeneID: 9738
NCBI-ProteinID: NP_001185951
OMIM: 609544
HGNC: 24342
Ensembl: ENSG00000103540
Vega: OTTHUMG00000131459
Pharos: O43303(Tbio)
UniProt: O43303
Position
16p12.3
AA seq 1012 aa AA seqDB search
MEEYEKFCEKSLARIQEASLSTESFLPAQSESISLIRFHGVAILSPLLNIEKRKEMQQEK
QKALDVEARKQVNRKKALLTRVQEILDNVQVRKAPNASDFDQWEMETVYSNSEVRNLNVP
ATFPNSFPSHTEHSTAAKLDKIAGILPLDNEDQCKTDGIDLARDSEGFNSPKQCDSSNIS
HVENEAFPKTSSATPQETLISDGPFSVNEQQDLPLLAEVIPDPYVMSLQNLMKKSKEYIE
REQSRRSLRGSINRIVNESHLDKEHDAVEVADCVKEKGQLTGKHCVSVIPDKPSLNKSNV
LLQGASTQASSMSMPVLASFSKVDIPIRTGHPTVLESNSDFKVIPTFVTENNVIKSLTGS
YAKLPSPEPSMSPKMHRRRSRTSSACHILINNPINACELSPKGKEQAMDLIIQDTDENTN
VPEIMPKLPTDLAGVCSSKVYVGKNTSEVKEDVVLGKSNQVCQSSGNHLENKVTHGLVTV
EGQLTSDERGAHIMNSTCAAMPKLHEPYASSQCIASPNFGTVSGLKPASMLEKNCSLQTE
LNKSYDVKNPSPLLMQNQNTRQQMDTPMVSCGNEQFLDNSFEKVKRRLDLDIDGLQKENC
PYVITSGITEQERQHLPEKRYPKGSGFVNKNKMLGTSSKESEELLKSKMLAFEEMRKRLE
EQHAQQLSLLIAEQEREQERLQKEIEEQEKMLKEKKAMTAEASELDINNAVELEWRKISD
SSLLETMLSQADSLHTSNSNSSGFTNSAMQYSFVSANEAPFYLWGSSTSGLTKLSVTRPF
GRAKTRWSQVFSLEIQAKFNKITAVAKGFLTRRLMQTDKLKQLRQTVKDTMEFIRSFQSE
APLKRGIVSAQDASLQERVLAQLRAALYGIHDIFFVMDAAERMSILHHDREVRKEKMLRQ
MDKMKSPRVALSAATQKSLDRKKYMKAAEMGMPNKKFLVKQNPSETRVLQPNQGQNAPVH
RLLSRQGTPKTSVKGVVQNRQKPSQSRVPNRVPVSGVYAGKIQRKRPNVATI
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtatgagaagttctgtgaaaaaagtcttgccagaatacaagaagcatcacta
tccacagagagctttctccctgctcagtctgaaagtatctcacttattcgctttcatgga
gtggctatcctttctccactgcttaacattgagaaaagaaaggaaatgcaacaagaaaag
cagaaagcacttgatgtagaagcaagaaagcaggttaacaggaagaaagctttactgact
cgtgtccaggagattcttgacaatgttcaggttagaaaagcacctaatgccagtgatttt
gatcagtgggagatggaaacagtttactctaattcagaagtcagaaacttgaatgttcct
gctacatttccaaatagctttccaagccatacggaacactctactgcagcaaagcttgat
aagatagctgggattttgccattggataatgaggaccaatgtaaaactgatggaatagac
ttagctagagattcagaaggatttaattctccgaagcaatgtgatagttccaatattagt
catgtagaaaatgaagcttttccaaagacctcttcagcaaccccacaagaaactcttatt
tctgatggtcccttctcagtaaatgaacaacaggatctaccacttttggcagaagtcatc
ccagatccctatgtaatgagtcttcagaatctgatgaaaaagtcaaaggaatatatagaa
agagaacaatctagacgcagtctgagaggtagtatcaacagaattgttaatgagagtcat
ttagacaaagaacatgatgctgttgaagtggctgactgtgtaaaagagaaaggccagttg
acaggcaaacactgtgtctcagttattcctgacaaaccaagccttaataaatcaaatgtt
cttctccaaggtgcttccactcaagcaagcagcatgagtatgccagttttagctagcttt
tcgaaagtggacatacctatacgaactggccatcccactgttctagagtctaattctgat
tttaaagttattcccacttttgttaccgaaaataatgttatcaaaagtcttacaggttca
tatgccaaattacctagtccagagccaagtatgagtcctaaaatgcaccgaagacgttcc
aggacatcatcagcgtgtcatatacttataaataacccaataaatgcctgtgaattaagc
cctaaaggaaaagaacaggcaatggacttaattattcaagatactgatgaaaacacaaat
gtgcccgaaattatgccaaagttaccaactgatttagcgggagtttgttcaagcaaggtt
tatgtgggcaaaaatacatctgaagtcaaagaagatgtggttttaggtaaatcaaatcag
gtatgtcaatcttcaggaaatcatttagaaaataaagttactcatggacttgttactgtg
gaaggtcagttaacatccgatgagagaggcgcacacataatgaacagtacctgtgctgcg
atgccaaagctgcatgaaccatatgccagcagtcagtgtatagcaagtccaaactttgga
actgtgagtggactcaagccagccagtatgttagagaaaaactgcagtttgcaaacagaa
ctgaataagtcttatgatgtaaaaaacccttctcctttattgatgcaaaaccagaatacg
agacagcagatggacacacctatggtgtcctgtggaaatgaacaatttttggataacagt
tttgagaaagttaaacggagacttgatttagatattgatggtttgcaaaaagaaaactgc
ccttatgtcataacaagtggaataactgaacaagaaaggcaacatttgccagaaaaaaga
taccctaagggatctggcttcgttaacaagaataaaatgttaggaactagttccaaagaa
agcgaggagttactaaaaagcaagatgttagcttttgaagaaatgcggaagagactagaa
gaacagcacgcccagcaattatcactactcatagctgagcaggaaagggaacaagaaaga
ctgcaaaaggaaatagaagagcaggagaaaatgttaaaagagaagaaggcaatgacagcg
gaagcctctgagttggacattaacaatgcagtggaattagaatggagaaaaataagtgac
tctagtttgctggaaacaatgctgtctcaagcggactcactccatacttcaaattcaaat
agttctggtttcacaaattctgccatgcaatatagctttgtttctgcaaacgaagcacca
ttctacctctggggatcatcaactagtggcttgaccaaactctcagtaacaaggcctttt
ggaagagccaaaactagatggtctcaagtttttagtctggaaatacaagcaaaatttaac
aaaataactgcagtggcaaaaggatttcttactcgtagacttatgcagacagataagctg
aagcaacttcgacaaactgtaaaagatactatggaattcataagaagttttcagtcagaa
gcaccattaaagagaggcattgtttcagctcaagatgcttcacttcaggaaagagtgtta
gctcagttgcgagctgccttgtacggtattcatgacatattctttgtaatggatgcagct
gaaagaatgtctattctacatcatgatcgagaagttcgcaaagagaaaatgctcaggcaa
atggataaaatgaaaagtccacgagtggctctttcagctgcaacacagaagtctcttgat
aggaagaaatacatgaaagctgctgaaatgggaatgccaaataagaaatttctggttaaa
caaaatccttctgaaacaagagtccttcagccaaaccaaggacagaatgcacctgttcat
aggctacttagtagacaaggaacccctaagacatcagtgaagggggttgtgcaaaataga
cagaagccttcacagagcagagtgcctaacagagtgcctgtttcaggagtatatgcagga
aaaatccaaagaaagcggccaaatgttgcgacaatttaa

DBGET integrated database retrieval system