KEGG   Homo sapiens (human): 9741Help
Entry
9741              CDS       T01001                                 

Gene name
LAPTM4A, HUMORF13, LAPTM4, MBNT, Mtrp
Definition
(RefSeq) lysosomal protein transmembrane 4 alpha
  KO
K12387  lysosomal-associated transmembrane protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    9741 (LAPTM4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mtp
Motif
Other DBs
NCBI-GeneID: 9741
NCBI-ProteinID: NP_055528
HGNC: 6924
Ensembl: ENSG00000068697
Vega: OTTHUMG00000090750
Pharos: Q15012(Tbio)
UniProt: Q15012 Q6IBP4
Position
2p24.1
AA seq 233 aa AA seqDB search
MVSMSFKRNRSDRFYSTRCCGCCHVRTGTIILGTWYMVVNLLMAILLTVEVTHPNSMPAV
NIQYEVIGNYYSSERMADNACVLFAVSVLMFIISSMLVYGAISYQVGWLIPFFCYRLFDF
VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFALFIIFKAYLI
NCVWNCYKYINNRNVPEIAVYPAFEAPPQYVLPTYEMAVKMPEKEPPPPYLPA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccatgagtttcaagcggaaccgcagtgaccggttctacagcacccggtgctgc
ggctgttgccatgtccgcaccgggacgatcatcctggggacctggtacatggtagtaaac
ctattgatggcaattttgctgactgtggaagtgactcatccaaactccatgccagctgtc
aacattcagtatgaagtcatcggtaattactattcgtctgagagaatggctgataatgcc
tgtgttctttttgccgtctctgttcttatgtttataatcagttcaatgctggtttatgga
gcaatttcttatcaagtgggttggctgattccattcttctgttaccgactttttgacttc
gtcctcagttgcctggttgctattagttctctcacctatttgccaagaatcaaagaatat
ctggatcaactacctgattttccctacaaagatgacctcctggccttggactccagctgc
ctcctgttcattgttcttgtgttctttgccttattcatcatttttaaggcttatctaatt
aactgtgtttggaactgctataaatacatcaacaaccgaaacgtgccggagattgctgtg
taccctgcctttgaagcacctcctcagtacgttttgccaacctatgaaatggccgtgaaa
atgcctgaaaaagaaccaccacctccttacttacctgcctga

DBGET integrated database retrieval system