KEGG   Homo sapiens (human): 9743Help
Entry
9743              CDS       T01001                                 

Gene name
ARHGAP32, GC-GAP, GRIT, PX-RICS, RICS, p200RhoGAP, p250GAP
Definition
(RefSeq) Rho GTPase activating protein 32
  KO
K20647  Rho GTPase-activating protein 32
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9743 (ARHGAP32)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    9743 (ARHGAP32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP SH3_9 SH3_2 SH3_1 PX RPEL
Motif
Other DBs
NCBI-GeneID: 9743
NCBI-ProteinID: NP_001136157
OMIM: 608541
HGNC: 17399
Ensembl: ENSG00000134909
Vega: OTTHUMG00000165774
Pharos: A7KAX9(Tbio)
UniProt: A7KAX9 Q86T64
Structure
PDB: 

Position
11q24.3
AA seq 2087 aa AA seqDB search
METESESSTLGDDSVFWLESEVIIQVTDCEEEEREEKFRKMKSSVHSEEDDFVPELHRNV
HPRERPDWEETLSAMARGADVPEIPGDLTLKTCGSTASMKVKHVKKLPFTKGHFPKMAEC
AHFHYENVEFGSIQLSLSEEQNEVMKNGCESKELVYLVQIACQGKSWIVKRSYEDFRVLD
KHLHLCIYDRRFSQLSELPRSDTLKDSPESVTQMLMAYLSRLSAIAGNKINCGPALTWME
IDNKGNHLLVHEESSINTPAVGAAHVIKRYTARAPDELTLEVGDIVSVIDMPPKVLSTWW
RGKHGFQVGLFPGHCVELINQKVPQSVTNSVPKPVSKKHGKLITFLRTFMKSRPTKQKLK
QRGILKERVFGCDLGEHLLNSGFEVPQVLQSCTAFIERYGIVDGIYRLSGVASNIQRLRH
EFDSEHVPDLTKEPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSDAVSAATDEERLI
KIHDVIQQLPPPHYRTLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNLLRSKQIESACF
SGTAAFMEVRIQSVVVEFILNHVDVLFSGRISMAMQEGAASLSRPKSLLVSSPSTKLLTL
EEAQARTQAQVNSPIVTENKYIEVGEGPAALQGKFHTIIEFPLERKRPQNKMKKSPVGSW
RSFFNLGKSSSVSKRKLQRNESEPSEMKAMALKGGRAEGTLRSAKSEESLTSLHAVDGDS
KLFRPRRPRSSSDALSASFNGEMLGNRCNSYDNLPHDNESEEEGGLLHIPALMSPHSAED
VDLSPPDIGVASLDFDPMSFQCSPPKAESECLESGASFLDSPGYSKDKPSANKKDAETGS
SQCQTPGSTASSEPVSPLQEKLSPFFTLDLSPTEDKSSKPSSFTEKVVYAFSPKIGRKLS
KSPSMSISEPISVTLPPRVSEVIGTVSNTTAQNASSSTWDKCVEERDATNRSPTQIVKMK
TNETVAQEAYESEVQPLDQVAAEEVELPGKEDQSVSSSQSKAVASGQTQTGAVTHDPPQD
SVPVSSVSLIPPPPPPKNVARMLALALAESAQQASTQSLKRPGTSQAGYTNYGDIAVATT
EDNLSSSYSAVALDKAYFQTDRPAEQFHLQNNAPGNCDHPLPETTATGDPTHSNTTESGE
QHHQVDLTGNQPHQAYLSGDPEKARITSVPLDSEKSDDHVSFPEDQSGKNSMPTVSFLDQ
DQSPPRFYSGDQPPSYLGASVDKLHHPLEFADKSPTPPNLPSDKIYPPSGSPEENTSTAT
MTYMTTTPATAQMSTKEASWDVAEQPTTADFAAATLQRTHRTNRPLPPPPSQRSAEQPPV
VGQVQAATNIGLNNSHKVQGVVPVPERPPEPRAMDDPASAFISDSGAAAAQCPMATAVQP
GLPEKVRDGARVPLLHLRAESVPAHPCGFPAPLPPTRMMESKMIAAIHSSSADATSSSNY
HSFVTASSTSVDDALPLPLPVPQPKHASQKTVYSSFARPDVTTEPFGPDNCLHFNMTPNC
QYRPQSVPPHHNKLEQHQVYGARSEPPASMGLRYNTYVAPGRNASGHHSKPCSRVEYVSS
LSSSVRNTCYPEDIPPYPTIRRVQSLHAPPSSMIRSVPISRTEVPPDDEPAYCPRPLYQY
KPYQSSQARSDYHVTQLQPYFENGRVHYRYSPYSSSSSSYYSPDGALCDVDAYGTVQLRP
LHRLPNRDFAFYNPRLQGKSLYSYAGLAPRPRANVTGYFSPNDHNVVSMPPAADVKHTYT
SWDLEDMEKYRMQSIRRESRARQKVKGPVMSQYDNMTPAVQDDLGGIYVIHLRSKSDPGK
TGLLSVAEGKESRHAAKAISPEGEDRFYRRHPEAEMDRAHHHGGHGSTQPEKPSLPQKQS
SLRSRKLPDMGCSLPEHRAHQEASHRQFCESKNGPPYPQGAGQLDYGSKGIPDTSEPVSY
HNSGVKYAASGQESLRLNHKEVRLSKEMERPWVRQPSAPEKHSRDCYKEEEHLTQSIVPP
PKPERSHSLKLHHTQNVERDPSVLYQYQPHGKRQSSVTVVSQYDNLEDYHSLPQHQRGVF
GGGGMGTYVPPGFPHPQSRTYATALGQGAFLPAELSLQHPETQIHAE
NT seq 6264 nt NT seq  +upstreamnt  +downstreamnt
atggagactgaaagtgagagtagcactttaggggatgacagtgtcttctggttggagtct
gaagttataatccaggtgactgactgtgaagaggaagaaagggaagagaagttcaggaag
atgaagtcctcagtacattctgaagaagatgattttgttccagagctacatagaaatgta
caccctcgagagcggcctgattgggaagaaactcttagcgcaatggcaagaggcgcagat
gttccagagattcctggagatcttactcttaagacgtgtggcagtacagccagtatgaag
gttaagcatgtgaaaaagttacccttcactaaaggtcactttccgaagatggctgaatgt
gcgcatttccattatgagaatgttgagttcggcagcatacagctttcactttcagaagaa
cagaatgaagtaatgaaaaatggctgtgaatctaaagagctggtctacctcgtgcagatt
gcttgtcagggaaaaagttggattgttaaaagaagttatgaagattttcgggtacttgat
aaacatcttcatctgtgtatttatgaccgaagattttcccagctctcagaacttccccgt
tctgacaccctgaaggacagtccagagtcggtcactcagatgcttatggcttacctgtca
cgcctttcagctatcgctggcaacaagatcaactgtgggcccgcccttacctggatggag
attgataataagggaaatcaccttttggttcatgaggagtcatccatcaacactcctgct
gtcggtgctgcccatgttatcaagaggtacactgctcgggcccctgacgaactgacctta
gaggtgggagacattgtttctgttattgacatgcccccgaaagtgttaagcacatggtgg
agaggcaagcacggattccaggtgggactcttccctggacactgtgttgagttaattaac
caaaaagttccccagtcagtgaccaactcagtgccaaaaccagtgtctaaaaagcacggc
aagctcattacgttcttacgaacattcatgaagtctcgtccaacaaaacagaagctgaag
cagcggggaatcttgaaagagagggtgtttggttgtgacctgggggaacaccttctaaat
tctggttttgaagtgccgcaggttcttcaaagctgcacagcattcattgagagatatggc
atcgtggatggaatctatcgcctttctggtgttgcctccaatatccagagactacgccat
gaatttgactctgagcacgtccccgacctgacgaaagaaccgtatgttcaggacatccat
tctgtgggttccctatgtaagctgtacttccgggaactcccaaaccctctgcttacctac
cagctgtatgagaaattttctgatgcagtttcagcagcaacagatgaagaaaggctgata
aaaatccacgatgtcatccagcagctccccccaccacactacagaacactggagttcctg
atgagacacttgtctcttctagctgactattgttccatcacaaatatgcatgcaaaaaat
ctagcaattgtttgggctccaaacctgttaagatcaaaacagatagaatctgcctgcttc
agtggaacagcagctttcatggaagtgaggattcagtctgtggttgttgagttcatcctg
aatcacgttgatgtgctgttcagcggcagaatcagcatggccatgcaagagggggcagct
tctctatcaaggcccaagtccctcctggtatcctctccatccaccaaactgctgacattg
gaagaggcccaggcacgaacacaagctcaggtcaattctccaattgtgacggaaaataaa
tatatcgaagtaggagaaggacctgctgcacttcaggggaaatttcataccataattgag
ttcccacttgaaagaaagaggcctcaaaataagatgaaaaagtctcctgtgggtagctgg
cgttcctttttcaacttggggaaatcatcatctgtttctaaacgaaagctgcagcggaat
gagagtgagccttcagagatgaaagccatggctctgaaaggtggcagggcagaaggaacc
ctccgttcagctaaaagtgaggagtctcttacatctctccatgcagttgatggtgattct
aagctcttccgacccagaagacccagatcttccagtgatgcactgtctgcctcttttaat
ggagaaatgctggggaaccgctgtaactcctatgataatctgcctcatgacaatgagagt
gaggaggaaggagggctgcttcatatcccagcccttatgtctcctcattcagctgaggat
gttgacttgagcccaccagacattggagtagccagcctggattttgatccaatgtcattt
caatgtagtcctcctaaggccgaatcagaatgtctggagagtggtgcttcctttttagat
tcaccaggatactccaaggataaaccaagtgccaataaaaaggatgcagaaacaggtagt
agccaatgtcagactccaggaagcacagcaagctctgaacctgtctctcctcttcaggag
aaactgagtccattctttaccctggacttgagcccaactgaagataaatcatctaagcca
tcctcctttactgaaaaggtcgtctatgctttctctccgaagataggacggaaattaagc
aaatcaccttctatgagcatatctgagccaatttcagtgaccctaccaccacgggtgtca
gaagtcattggtacagtctcaaataccacagctcagaatgcatcatcttcaacctgggac
aaatgcgttgaagaaagggatgccacaaatagatcccccacccagatagtaaagatgaaa
acaaatgagacagttgcccaagaagcatatgaatctgaagtccagcccctggaccaggtg
gctgctgaagaagtagaattgccagggaaagaggatcagtctgtctcaagcagtcagagt
aaggctgtagcttctggacagactcagacaggagcagttacccatgacccccctcaggat
tccgttcctgtcagttcagtctctcttatcccaccaccaccgcctccgaaaaatgttgcc
cgaatgttggcgctagcattagctgagtccgcacagcaagcctcaactcagtcattgaag
agaccagggacctctcaggctgggtatacaaattatggagacatagcggtggctacaact
gaagataatctgtccagttcttactctgcagttgctctagataaggcctatttccaaacc
gatcgaccagcagagcagttccacctccagaataatgcaccaggaaactgtgaccatcct
ctaccagagacaacagctactggggatcctacccattccaacacaactgaatctggggag
caacatcaccaagtagacttaacagggaatcagccacatcaagcatatttatctggggac
ccagaaaaggccagaattacttcagttcccttagactcagagaagtctgatgatcatgta
agtttccctgaagaccagtctgggaagaacagtatgccaactgtctccttcttggatcag
gaccagtctccaccccgtttctacagtggagatcagcctccttcttatcttggtgcaagt
gtggataaactccatcaccctttagaatttgcagacaaatctcccacacctcctaattta
cctagcgataaaatctaccctccttctgggtcccccgaagagaataccagcacagccacc
atgacttacatgacaactactccagcaacagcccaaatgagcaccaaggaagccagctgg
gatgtggctgaacaacccaccactgctgattttgctgctgccacacttcagcgcacgcac
agaactaatcgtccccttccccctccgccttcccagagatctgcagagcagccaccagtt
gtggggcaggtacaagcagcaaccaatataggattaaataattcccacaaggttcaagga
gtagttccagttccagagaggccacctgaacctcgagccatggatgaccctgcgtctgcc
ttcatcagtgacagtggtgctgctgctgctcagtgtcccatggctacagctgtccagcca
ggcctgcctgagaaagtgcgggacggtgcccgggtcccgctgctgcacctgcgcgccgag
tctgtccctgcgcatccctgtggctttcctgcaccactgccccccaccaggatgatggag
agtaagatgattgctgccatacactccagcagtgcagatgccaccagcagttcaaattat
cattcctttgtcactgcttcatccacctctgtggacgatgcattgcctttaccacttcct
gtcccacaacctaagcatgcttctcagaaaacagtttactcctcctttgctaggcccgat
gtcaccactgaaccctttggtccagataactgtttgcatttcaatatgactccaaactgc
cagtaccgtccccagagtgtacctccccatcacaataaattggagcagcaccaagtgtat
ggtgccaggtcagagccaccagcctccatgggtcttcgttataacacatatgtggcccca
ggaagaaacgcatctggacaccactccaagccatgcagccgggtcgagtatgtgtcttct
ttgagctcctctgtcaggaatacctgttaccccgaagacattccaccgtaccctaccatc
cggagagtgcagtctctccatgctccgccgtcttccatgattcgctctgttcccatttca
cggacagaagttcccccagatgatgagccagcctactgcccaagacctctgtaccaatat
aagccatatcagtcctcccaggcccgctcagattatcatgtcactcagcttcagccttac
tttgagaatggccgggtccactacaggtatagcccatattccagttcttctagttcctat
tacagtccagatggggccctgtgtgatgtggatgcctatggcacagtccagttgagaccc
cttcaccgccttcccaatcgagactttgctttctacaatcctaggctgcaaggaaagagc
ttgtacagttatgctggtttggctccacgtccccgggccaacgtgactggctatttctct
cccaacgaccataatgtagtcagcatgcctccggctgctgatgtgaagcacacctacacc
tcatgggatcttgaggacatggaaaaataccgcatgcagtccatccggagagagagccgt
gctcggcagaaggtgaaagggcctgtcatgtcccaatatgataacatgaccccggcggtg
caggacgacttgggtgggatctatgtcatccatctgcgtagtaaatcagatcctgggaaa
actggacttctctcagtggcagaaggaaaggagagccgccatgcagccaaggccatcagt
cccgagggagaggaccgcttctataggaggcatcccgaggcagagatggacagagcccac
catcacggaggccatggtagcacgcagccggagaagccatccctgcctcagaagcagagc
agcctgaggagcaggaagcttcctgacatgggctgcagtcttcctgagcacagggcacac
caagaagcaagccataggcagttctgtgagtcaaagaatgggcccccttatccccaggga
gctggccagttagattatgggtccaaagggattccagacacttctgagccagtcagctac
cacaactctggagtaaaatatgctgcatccgggcaagaatctttaagactgaaccacaaa
gaggtaaggctctccaaagagatggagcgaccctgggttaggcagccttctgccccagag
aaacactccagagactgctacaaggaggaagaacacctcactcagtcaatcgtcccaccc
cctaaaccagagaggagtcatagcctcaaactccatcatacccagaacgtggagagggac
cccagtgtgctgtaccagtaccaaccacacggcaagcgccagagcagtgtgactgttgtg
tcccagtatgataacctggaagattaccactccctgcctcagcaccagcgaggagtcttt
ggagggggcggcatggggacgtatgtgccccctggctttccccatccacagagcaggacc
tatgctacagcgttgggtcaaggggccttcctgcccgcagagttgtccttgcagcatcct
gaaacacagatccatgcagaatga

DBGET integrated database retrieval system