KEGG   Homo sapiens (human): 9749Help
Entry
9749              CDS       T01001                                 

Gene name
PHACTR2, C6orf56
Definition
(RefSeq) phosphatase and actin regulator 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RPEL
Motif
Other DBs
NCBI-GeneID: 9749
NCBI-ProteinID: NP_055536
OMIM: 608724
HGNC: 20956
Ensembl: ENSG00000112419
Vega: OTTHUMG00000015732
Pharos: O75167(Tbio)
UniProt: O75167
Position
6q24.2
AA seq 634 aa AA seqDB search
MDNAVDGLDKASIANSDGPTAGSQTPPFKRKGKLSTIGKIFKPWKWRKKKTSDKFRETSA
VLERKISTRQSREELIRRGVLKELPDQDGDVTVNFENSNGHMIPIGEESTREENVVKSEE
GNGSVSEKTPPLEEQAEDKKENTENHSETPAAPALPPSAPPKPRPKPKPKKSPVPPKGAT
AGASHKGDEVPPIKKNTKAPGKQAPVPPPKPASRNTTREAAGSSHSKKTTGSKASASPST
SSTSSRPKASKETVSSKAGTVGTTKGKRKTDKQPITSHLSSDTTTSGTSDLKGEPAETRV
ESFKLEQTVPGAEEQNTGKFKSMVPPPPVAPAPSPLAPPLPLEDQCITASDTPVVLVSVG
ADLPVSALDPSQLLWAEEPTNRTTLYSGTGLSVNRENAKCFTTKEELGKTVPQLLTPGLM
GESSESFSASEDEGHREYQANDSDSDGPILYTDDEDEDEDEDGSGESALASKIRRRDTLA
IKLGNRPSKKELEDKNILQRTSEEERQEIRQQIGTKLVRRLSQRPTTEELEQRNILKQKN
EEEEQEAKMELKRRLSRKLSLRPTVAELQARRILRFNEYVEVTDSPDYDRRADKPWARLT
PADKAAIRKELNEFKSTEMEVHEESRQFTRFHRP
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgccgttgacggactggacaaagcttctatagcaaactcagatggccccaca
gcaggttcccaaacacctcccttcaaaagaaaggggaaactatccaccattggtaaaatc
tttaagccttggaaatggaggaaaaagaagaccagcgacaaatttagagaaacctcggca
gtattagaaaggaagatatccacacgacaaagtagagaggagctgataagaaggggagtg
cttaaggaattgcctgatcaagatggagatgtaacagttaactttgaaaattcaaacggg
cacatgatacccatcggagaggaatctacccgagaggaaaatgtagtaaagtctgaagaa
ggtaatggctctgtatctgaaaaaacaccacctctggaggaacaggcagaagataagaaa
gagaacactgaaaaccactctgaaacaccggcagctcctgctctacctccttctgctcct
cctaagcctagacccaaacctaaacccaaaaaatcacctgtgcctccgaaaggggccact
gctggggccagccacaaaggtgatgaagtgcctcccattaaaaaaaataccaaggctcct
ggtaagcaggcccccgtccctccacccaagccagcaagccgaaacacgacccgagaggct
gctggctcctctcattcaaaaaaaacaactggctctaaagcatcagcttcgccatccact
tcatccacctcatctcgtcccaaagcttcaaaggagacagtttctagcaaagcagggaca
gtggggaccaccaagggcaagagaaaaactgacaagcagccaataacttctcacctgtcc
tcagacacaacaacttctggcacatccgacctgaaaggagagcctgcagagaccagagtg
gagagtttcaaactcgaacagactgtccctggagctgaggagcagaacacaggcaaattc
aagtccatggtccctccaccccctgtggctccagcaccttctcctctggccccccctctc
cctcttgaggatcagtgcattactgcctcagacactccagttgtcctcgtcagcgttgga
gctgacctgcccgtctctgccttagacccaagtcagcttctttgggctgaagagccgacg
aacagaaccactctctactcaggcactggcttaagtgttaacagagaaaatgcaaaatgt
ttcacaaccaaagaggagctggggaagacagtgcctcagctactgactcctgggctgatg
ggcgaatcttcagaatcctttagtgcctcagaagatgaaggccacagggaataccaagcc
aatgactctgactcggacgggcctatcttgtacaccgatgatgaggacgaagacgaagat
gaggatggcagtggagaaagtgctttggcaagtaaaatacgccggagggatactcttgct
atcaaacttggcaacagaccatctaagaaagaactagaggacaaaaacatcttgcagcgt
acatctgaagaagagaggcaggaaatccgacaacaaattggaaccaagttagtcaggagg
ctgagccagaggcccacaactgaagaattagagcaaagaaacatcctaaaacaaaagaat
gaagaagaggaacaagaagcaaaaatggaacttaaacgcagactcagcagaaagctcagc
ctgagacccacagtggcagagctacaagctcgaaggatcctgcgatttaacgagtatgta
gaagtcacggattctcctgactatgaccgccgagcagacaagccctgggccaggttaaca
cctgcagacaaggcagcaataaggaaagaactaaatgaatttaaaagcacagaaatggaa
gttcatgaagagagtcgacagtttacaaggtttcatcgtccataa

DBGET integrated database retrieval system