KEGG   Homo sapiens (human): 9754Help
Entry
9754              CDS       T01001                                 

Gene name
STARD8, ARHGAP38, DLC3, STARTGAP3
Definition
(RefSeq) StAR related lipid transfer domain containing 8
  KO
K20632  deleted in liver cancer protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9754 (STARD8)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    9754 (STARD8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: START RhoGAP
Motif
Other DBs
NCBI-GeneID: 9754
NCBI-ProteinID: NP_001135976
OMIM: 300689
HGNC: 19161
Ensembl: ENSG00000130052
Vega: OTTHUMG00000021748
Pharos: Q92502(Tbio)
UniProt: Q92502
Position
Xq13.1
AA seq 1023 aa AA seqDB search
MTLNNCASMKLEVHFQSKQNEDSEEEEQCTISSHWAFQQESKCWSPMGSSDLLAPPSPGL
PATSSCESVLTELSATSLPVITVSLPPEPADLPLPGRAPSSSDRPLLSPTQGQEGPQDKA
KKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKVSKASSFRSCRGFLSAGFYRAK
NWAATSAGGSGANTRKAWEAWPVASFRHPQWTHRGDCLVHVPGDHKPGTFPRSLSIESLC
PEDGHRLADWQPGRRWGCEGRRGSCGSTGSHASTYDNLPELYPAEPVMVGAEAEDEDDEE
SGGSYAHLDDILQHVWGLQQRVELWSRAMYPDLGPGDEEEEEATSSVEIATVEVKCQAEA
LSQMEVPAHGESPAWAQAEVQPAVLAPAQAPAEAEPVAQEEAEAPAPAPAPAPAQDSEQE
AHSGGEPTFASSLSVEEGHSISDTVASSSELDSSGNSMNEAEAAGPLAGLQASMPRERRD
SGVGASLTRPCRKLRWHSFQNSHRPSLNSESLEINRQFAGQINLLHKGSLLRLTAFMEKY
TVPHKQGWVWSMPKFMRRNKTPDYRGQHVFGVPPLIHVQRTGQPLPQSIQQAMRYLRSQC
LDQVGIFRKSGVKSRIQNLRQMNETSPDNVCYEGQSAYDVADLLKQYFRDLPEPIFTSKL
TTTFLQIYQLLPKDQWLAAAQAATLLLPDENREVLQTLLYFLSDIASAEENQMTAGNLAV
CLAPSIFHLNVSKKDSPSPRIKSKRSLIGRPGPRDLSDNMAATQGLSHMISDCKKLFQVP
QDMVLQLCSSYSAAELSPPGPALAELRQAQAAGVSLSLYMEENIQDLLRDAAERFKGWMS
VPGPQHTELACRKAPDGHPLRLWKASTEVAAPPAVVLHRVLRERALWDEDLLRAQVLEAL
MPGVELYHYVTDSMAPHPCRDFVVLRMWRSDLPRGGCLLVSQSLDPEQPVPESGVRALML
TSQYLMEPCGLGRSRLTHICRADLRGRSPDWYNKVFGHLCAMEVAKIRDSFPTLQAAGPE
TKL
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgaataattgtgcctcgatgaaactggaggttcattttcaaagcaagcagaat
gaagactcagaagaggaagagcagtgtaccatcagtagccactgggccttccagcaggaa
agtaagtgctggtctcctatggggtcctctgatctgttggccccaccgagccctggcctg
ccagcgacctcaagctgtgagagcgtcctcaccgagcttagtgccacctctctgccagtc
atcaccgtgagcctaccacccgagccagcagacttgcccttgccaggccgtgcccccagc
tcgagtgaccggcccctcctcagccccacccagggccaggagggtccccaggacaaagcc
aagaagcgccatcgtaaccgtagcttcctcaagcaccttgaatctctgaggcggaaggaa
aagagtggcagccagcaagcagagcccaagcatagtccagccacctcagagaaggtctcc
aaagcctcatctttccgcagttgtcgtggcttcctctcagctggattttacagggccaag
aactgggccgccacctcagccggtggcagtggtgccaatactcggaaggcctgggaggcc
tggcctgtggcctcgttccggcatcctcagtggacacaccggggtgattgcctggtgcac
gttcctggggaccacaaaccaggcacattccctcgctccctgtccattgagagcctgtgt
cctgaggatggacaccgcctggcagactggcagccaggtaggcggtggggctgtgagggg
cgccggggctcctgtggctcaacgggcagccatgccagcacgtatgacaacttgcctgag
ctgtacccagctgagcctgtaatggttggggctgaggctgaagatgaagatgatgaggag
agtgggggcagctatgctcacctagacgacatcctccagcacgtgtgggggctacagcaa
cgagtagagctgtggtctcgggccatgtacccagacctggggcctggagatgaggaagag
gaggaggccacttcatcagtagaaatagccacagttgaggtcaaatgccaagctgaggct
ctcagccagatggaggttccggcccatggagagtccccagcctgggcccaggctgaagtc
cagccagcagtcctggctccggctcaggctccagctgaggctgaaccagtggcacaggaa
gaggctgaggccccggccccagccccggccccggccccagcccaggacagtgagcaggag
gcacattcaggcggggaacccacctttgcctctagcctgtctgtggaagaaggacactcc
atttctgacactgtggcctcctccagcgaacttgacagtagtgggaactccatgaatgag
gctgaggctgcggggcccctggctggactccaggcatcaatgccccgtgaacggcgcgat
tcaggtgttggggcctcacttaccagaccctgcaggaagctccgttggcatagcttccag
aactcccatcgtcccagcctcaactcagagtcgctggagatcaaccggcagtttgcaggc
cagatcaacctcctgcacaagggctcactgctgcggcttaccgcgttcatggagaagtac
actgtgccccacaagcagggctgggtctggtcaatgcccaagttcatgaggaggaacaag
accccagattaccggggacagcacgtatttggggtgccacccctcatccacgtgcagcgc
acgggccagccactgccacagagcattcagcaagccatgcgctacttgcgcagccagtgc
ctggaccaagtaggcatcttccgcaagtctggggtcaagtccaggatccagaacctgcgt
caaatgaatgagacctcgcctgacaatgtctgctacgagggccagtcagcctacgacgtg
gctgacctgctaaagcagtatttccgggacctgcctgagcccatcttcaccagcaagctc
accaccactttcctccagatctaccagctcctccccaaggatcagtggttggcagcagca
caagccgccaccttgctgctccccgatgagaaccgagaggtgctacagaccctgctctac
ttcttaagtgacattgcctctgccgaggaaaaccagatgacagcaggcaacctggcagtg
tgcctggcgccctccatcttccacctcaatgtctctaagaaggatagcccctctcccagg
atcaagagcaaacgcagcctcattggcaggccaggccctagggacctgagtgacaacatg
gcagccacccagggcctgtcgcacatgatcagtgactgcaagaaacttttccaggtgccc
caggacatggtgctgcagctgtgcagctcctacagcgcagctgagctcagccctcccggc
ccagccctggctgagctgcgtcaggcccaagctgcaggggtaagcctgagcctctacatg
gaagagaatatccaggacctgctgcgtgatgctgctgagcgcttcaagggctggatgagc
gtgccagggccccagcacacggagctggcttgcaggaaggcaccggatgggcaccccctg
cggctatggaaggcatccacagaggtggcagcccccccagctgtggtgctgcatcgtgtt
ctccgggagcgggccctctgggatgaggatctgctgcgggcccaggtgctggaagccctg
atgccgggtgtggagctgtaccactatgtcaccgacagcatggcaccccatccctgccgc
gactttgtggtgcttcggatgtggcgctctgacctgcctcgtgggggttgcctgcttgtc
tcccagtccctggatccggaacaacctgtgccagagtcgggtgtgcgagccctcatgctc
acatcccagtacctcatggagccttgcggcttgggccgctctcggctcacacacatctgc
cgggctgacctcaggggccgttctcctgactggtacaacaaagtctttggacacctgtgt
gccatggaagtggcaaagatccgggactccttccccaccctgcaggcagcgggccctgag
acaaagctgtga

DBGET integrated database retrieval system