KEGG   Homo sapiens (human): 9755Help
Entry
9755              CDS       T01001                                 

Gene name
TBKBP1, ProSAPiP2, SINTBAD
Definition
(RefSeq) TBK1 binding protein 1
  KO
K12652  TANK-binding kinase 1-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    9755 (TBKBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TBD Mod_r Zn-C2H2_12 CT_C_D Seryl_tRNA_N
Motif
Other DBs
NCBI-GeneID: 9755
NCBI-ProteinID: NP_055541
OMIM: 608476
HGNC: 30140
Ensembl: ENSG00000198933
Vega: OTTHUMG00000178286
Pharos: A7MCY6(Tbio)
UniProt: A7MCY6
Position
17q21.32
AA seq 615 aa AA seqDB search
MESMFEDDISILTQEALGPSEVWLDSPGDPSLGGDMCSASHFALITAYGDIKERLGGLER
ENATLRRRLKVYEIKYPLISDFGEEHGFSLYEIKDGSLLEVEKVSLQQRLNQFQHELQKN
KEQEEQLGEMIQAYEKLCVEKSDLETELREMRALVETHLRQICGLEQQLRQQQGLQDAAF
SNLSPPPAPAPPCTDLDLHYLALRGGSGLSHAGWPGSTPSVSDLERRRLEEALEAAQGEA
RGAQLREEQLQAECERLQGELKQLQETRAQDLASNQSERDMAWVKRVGDDQVNLALAYTE
LTEELGRLRELSSLQGRILRTLLQEQARSGGQRHSPLSQRHSPAPQCPSPSPPARAAPPC
PPCQSPVPQRRSPVPPCPSPQQRRSPASPSCPSPVPQRRSPVPPSCQSPSPQRRSPVPPS
CPAPQPRPPPPPPPGERTLAERAYAKPPSHHVKAGFQGRRSYSELAEGAAYAGASPPWLQ
AEAATLPKPRAYGSELYGPGRPLSPRRAFEGIRLRFEKQPSEEDEWAVPTSPPSPEVGTI
RCASFCAGFPIPESPAATAYAHAEHAQSWPSINLLMETVGSDIRSCPLCQLGFPVGYPDD
ALIKHIDSHLENSKI
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggagtccatgttcgaggacgacatcagcatcctgacgcaggaggccctggggcctagt
gaggtgtggctggacagtcccggagacccctcgcttgggggcgacatgtgctccgcctcc
cactttgccctcatcactgcttacggagacatcaaggaacggctggggggcctggagagg
gagaacgccaccctccgacgccgcctcaaagtctacgagatcaagtacccactgatcagt
gactttggagaggagcatggcttttctctgtatgaaatcaaggatggctccctgctggag
gtggagaaggtcagcctgcagcaacggctcaaccagttccagcatgagttacagaagaac
aaggagcaggaagaacagcttggagagatgatccaggcctacgagaaactctgcgtggag
aagagtgacttggagacagagctgagggagatgagggccctggtggagacgcacctgcgt
cagatctgtggtttggagcagcagctgcggcaacagcaaggcctccaggatgcagccttc
tccaacctgagcccaccgccagcccccgcccctccctgcactgatttagacctgcactac
ctggcactgagagggggatctggcttgagtcatgcaggctggccgggctccacacccagt
gtgagtgacctggagcggcggcggctagaagaggctttggaggccgcgcagggagaggcc
cggggggctcagctccgggaggagcagctccaggccgagtgcgagcggctgcagggggag
ctgaagcagctgcaggagacccgggcccaggatctggcctccaaccagtcggagcgagac
atggcgtgggtgaaaagagttggggatgatcaggtgaatttggcgctggcctacaccgag
ctgacggaggagctgggccggcttcgggagttgagttccctacaggggagaatcttgagg
actctgttgcaggaacaggcccggagtggcggccagaggcactcgccgctgtcacaacgc
cactccccggccccccagtgcccctccccctccccgcctgcccgagcggctcccccgtgc
cccccgtgccagtcccccgtcccccagcgccgctctcccgtgcccccgtgcccctcgccg
cagcagcgccgctctccggcctcaccctcctgcccgtcgcccgtcccgcagcgccgctcg
ccggtgccgccgtcgtgccagtcccccagcccgcagcgccgttccccggtgccccccagc
tgcccggccccgcagccccggccaccgccgccgcccccgccgggcgagaggacgctggcc
gagcgcgcctacgccaagccgcccagccaccacgtgaaggccggcttccagggccgccgc
agctactctgagctggcggagggcgcggcctacgcgggcgcctccccgccctggctgcag
gccgaagcggccactctccccaagccccgggcctacggcagcgagctctacggccctggc
aggcccctcagcccgcggcgcgccttcgagggcatccggctgcgcttcgagaagcagccg
tcggaggaggacgagtgggctgtgcccaccagcccgcccagcccggaggtgggcaccatc
cgctgcgcctccttctgcgcgggcttccccatccccgagtcgcccgccgccaccgcctac
gcccacgccgagcacgcgcagtcctggccgtccatcaacttgctgatggagacggtgggc
tccgacatccgcagctgccccctctgccagctgggtttccctgtcgggtacccggatgat
gccctcatcaaacacattgactcccacctggagaacagcaagatctag

DBGET integrated database retrieval system