KEGG   Homo sapiens (human): 9759Help
Entry
9759              CDS       T01001                                 

Gene name
HDAC4, AHO3, BDMR, HA6116, HD4, HDAC-4, HDAC-A, HDACA
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04371  Apelin signaling pathway
hsa05034  Alcoholism
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
Network
N00375  HPV E7 to TNF-IRF1 signaling pathway
Disease
H00561  Brachydactyly-mental retardation syndrome
Drug target
Belinostat: D08870
Entinostat: D09338
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Tucidinostat: D10993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    9759 (HDAC4)
 09160 Human Diseases
  09161 Cancers: Overview
   05206 MicroRNAs in cancer
    9759 (HDAC4)
   05203 Viral carcinogenesis
    9759 (HDAC4)
  09165 Substance dependence
   05034 Alcoholism
    9759 (HDAC4)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    9759 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9759 (HDAC4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     9759 (HDAC4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     9759 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 9759
NCBI-ProteinID: NP_006028
OMIM: 605314
HGNC: 14063
Ensembl: ENSG00000068024
Vega: OTTHUMG00000133344
Pharos: P56524(Tclin)
UniProt: P56524
Structure
PDB: 

Position
2q37.3
AA seq 1084 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP
SSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPA
TGPSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL
EQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHL
VIQQQHQQFLEKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPY
LDRLPGQKEAHAQAGVQVKQEPIESDEEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQ
RIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEPPTKPRFTTGLVYDT
LMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHT
LLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVE
LVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWD
VHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDP
PMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQL
MGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKV
MEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDEEPMEE
EPPL
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aatcctgcccgcgtgaaccacatgcccagcacggtggatgtggccacggcgctgcctctg
caagtggccccctcggcagtgcccatggacctgcgcctggaccaccagttctcactgcct
gtggcagagccggccctgcgggagcagcagctgcagcaggagctcctggcgctcaagcag
aagcagcagatccagaggcagatcctcatcgctgagttccagaggcagcacgagcagctc
tcccggcagcacgaggcgcagctccacgagcacatcaagcaacaacaggagatgctggcc
atgaagcaccagcaggagctgctggaacaccagcggaagctggagaggcaccgccaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaag
ggcaaagagagtgccgtggccagcacagaagtgaagatgaagttacaagaatttgtcctc
aataaaaagaaggcgctggcccaccggaatctgaaccactgcatttccagcgaccctcgc
tactggtacgggaaaacgcagcacagttcccttgaccagagttctccaccccagagcgga
gtgtcgacctcctataaccacccggtcctgggaatgtacgacgccaaagatgacttccct
cttaggaaaacagcttctgaaccgaatctgaaattacggtccaggctaaagcagaaagtg
gccgaaagacggagcagccccctgttacgcaggaaagacgggccagtggtcactgctcta
aaaaagcgtccgttggatgtcacagactccgcgtgcagcagcgccccaggctccggaccc
agctcacccaacaacagctccgggagcgtcagcgcggagaacggtatcgcgcccgccgtc
cccagcatcccggcggagacgagtttggcgcacagacttgtggcacgagaaggctcggcc
gctccacttcccctctacacatcgccatccttgcccaacatcacgctgggcctgcctgcc
accggcccctctgcgggcacggcgggccagcaggacgccgagagactcacccttcccgcc
ctccagcagaggctctcccttttccccggcacccacctcactccctacctgagcacctcg
cccttggagcgggacggaggggcagcgcacagccctcttctgcagcacatggtcttactg
gagcagccgccggcacaagcacccctcgtcacaggcctgggagcactgcccctccacgca
cagtccttggttggtgcagaccgggtgtccccctccatccacaagctgcggcagcaccgc
ccactggggcggacccagtcggccccgctgccccagaacgcccaggctctgcagcacctg
gtcatccagcagcagcatcagcagtttctggagaaacacaagcagcagttccagcagcag
caactgcagatgaacaagatcatccccaagccaagcgagccagcccggcagccggagagc
cacccggaggagacggaggaggagctccgtgagcaccaggctctgctggacgagccctac
ctggaccggctgccggggcagaaggaggcgcacgcacaggccggcgtgcaggtgaagcag
gagcccattgagagcgatgaggaagaggcagagcccccacgggaggtggagccgggccag
cgccagcccagtgagcaggagctgctcttcagacagcaagccctcctgctggagcagcag
cggatccaccagctgaggaactaccaggcgtccatggaggccgccggcatccccgtgtcc
ttcggcggccacaggcctctgtcccgggcgcagtcctcacccgcgtctgccaccttcccc
gtgtctgtgcaggagccccccaccaagccgaggttcacgacaggcctcgtgtatgacacg
ctgatgctgaagcaccagtgcacctgcgggagtagcagcagccaccccgagcacgccggg
aggatccagagcatctggtcccgcctgcaggagacgggcctccggggcaaatgcgagtgc
atccgcggacgcaaggccaccctggaggagctacagacggtgcactcggaagcccacacc
ctcctgtatggcacgaaccccctcaaccggcagaaactggacagtaagaaacttctaggc
tcgctcgcctccgtgttcgtccggctcccttgcggtggtgttggggtggacagtgacacc
atatggaacgaggtgcactcggcgggggcagcccgcctggctgtgggctgcgtggtagag
ctggtcttcaaggtggccacaggggagctgaagaatggctttgctgtggtccgcccccct
ggacaccatgcggaggagagcacgcccatgggcttttgctacttcaactccgtggccgtg
gcagccaagcttctgcagcagaggttgagcgtgagcaagatcctcatcgtggactgggac
gtgcaccatggaaacgggacccagcaggctttctacagcgaccccagcgtcctgtacatg
tccctccaccgctacgacgatgggaacttcttcccaggcagcggggctcctgatgaggtg
ggcacagggcccggcgtgggtttcaacgtcaacatggctttcaccggcggcctggacccc
cccatgggagacgctgagtacttggcggccttcagaacggtggtcatgccgatcgccagc
gagtttgccccggatgtggtgctggtgtcatcaggcttcgatgccgtggagggccacccc
acccctcttgggggctacaacctctccgccagatgcttcgggtacctgacgaagcagctg
atgggcctggctggcggccggattgtcctggccctcgagggaggccacgacctgaccgcc
atttgcgacgcctcggaagcatgtgtttctgccttgctgggaaacgagcttgatcctctc
ccagaaaaggttttacagcaaagacccaatgcaaacgctgtccgttccatggagaaagtc
atggagatccacagcaagtactggcgctgcctgcagcgcacaacctccacagcggggcgt
tctctgatcgaggctcagacttgcgagaacgaagaagccgagacggtcaccgccatggcc
tcgctgtccgtgggcgtgaagcccgccgaaaagagaccagatgaggagcccatggaagag
gagccgcccctgtag

DBGET integrated database retrieval system