KEGG   Homo sapiens (human): 976Help
Entry
976               CDS       T01001                                 

Gene name
ADGRE5, CD97, TM7LN1
Definition
(RefSeq) adhesion G protein-coupled receptor E5
  KO
K08446  CD97 antigen
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    976 (ADGRE5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    976 (ADGRE5)
   04030 G protein-coupled receptors [BR:hsa04030]
    976 (ADGRE5)
   04090 CD molecules [BR:hsa04090]
    976 (ADGRE5)
Peptidases and inhibitors [BR:hsa01002]
 Mixed peptidases
  Family P2
   976 (ADGRE5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   976 (ADGRE5)
G protein-coupled receptors [BR:hsa04030]
 Adhesion receptor family
  EGF-like module-containing mucin-like hormone receptor-like (EMR)
   976 (ADGRE5)
CD molecules [BR:hsa04090]
 Proteins
  976 (ADGRE5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 EGF_CA cEGF GPS EGF_MSP1_1 EGF_3 hEGF EGF FXa_inhibition Dicty_CAR Plasmod_Pvs28
Motif
Other DBs
NCBI-GeneID: 976
NCBI-ProteinID: NP_510966
OMIM: 601211
HGNC: 1711
Ensembl: ENSG00000123146
Vega: OTTHUMG00000182166
Pharos: P48960(Tbio)
UniProt: P48960
Position
19p13.12
AA seq 835 aa AA seqDB search
MGGRVFLAFCVWLTLPGAETQDSRGCARWCPQNSSCVNATACRCNPGFSSFSEIITTPTE
TCDDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDEC
QQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNN
VGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPG
WKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSSAEVTIQN
VIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTEL
TLMIQERGDKNVTMGQSSARMKLNWAVAAGAEDPGPAVAGILSIQNMTTLLANASLNLHS
KKQAELEEIYESSIRGVQLRRLSAVNSIFLSHNNTKELNSPILFAFSHLESSDGEAGRDP
PAKDVMPGPRQELLCAFWKSDSDRGGHWATEGCQVLGSKNGSTTCQCSHLSSFAILMAHY
DVEDWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICLFVGSTIFLAG
IENEGGQVGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGQGLSTRWLCLIGY
GVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFLWSFLGPVTFIILCNAVIFVTTVWKLTQ
KFSEINPDMKKLKKARALTITAIAQLFLLGCTWVFGLFIFDDRSLVLTYVFTILNCLQGA
FLYLLHCLLNKKVREEYRKWACLVAGGSKYSEFTSTTSGTGHNQTRALRASESGI
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgggaggccgcgtctttctcgcattctgtgtctggctgactctgccgggagctgaaacc
caggactccaggggctgtgcccggtggtgccctcagaactcctcgtgtgtcaatgccacc
gcctgtcgctgcaatccagggttcagctctttttctgagatcatcaccaccccgacggag
acttgtgacgacatcaacgagtgtgcaacaccgtcgaaagtgtcatgcggaaaattctcg
gactgctggaacacagaggggagctacgactgcgtgtgcagcccgggatatgagcctgtt
tctggggcaaaaacattcaagaatgagagcgagaacacctgtcaagatgtggacgaatgt
cagcagaacccaaggctctgtaaaagctacggcacctgcgtcaacacccttggcagctat
acctgccagtgcctgcctggcttcaagttcatacctgaggatccgaaggtctgcacagat
gtgaatgaatgcacctccggacaaaacccgtgccacagctccacccactgcctcaacaac
gtgggcagctatcagtgccgctgccgcccgggctggcaaccgattccggggtcccccaat
ggcccaaacaataccgtctgtgaagatgtggacgagtgcagctccgggcagcatcagtgt
gacagctccaccgtctgcttcaacaccgtgggttcatacagctgccgctgccgcccaggc
tggaagcccagacacggaatcccgaataaccaaaaggacactgtctgtgaagatatgact
ttctccacctggaccccgccccctggagtccacagccagacgctttcccgattcttcgac
aaagtccaggacctgggcagagactccaagacaagctcagccgaggtcaccatccagaat
gtcatcaaattggtggatgaactgatggaagctcctggagacgtagaggccctggcgcca
cctgtccggcacctcatagccacccagctgctctcaaaccttgaagatatcatgaggatc
ctggccaagagcctgcctaaaggccccttcacctacatttccccttcgaacacagagctg
accctgatgatccaggagcggggggacaagaacgtcactatgggtcagagcagcgcacgc
atgaagctgaattgggctgtggcagctggagccgaggatccaggccccgccgtggcgggc
atcctctccatccagaacatgacgacattgctggccaatgcctccttgaacctgcattcc
aagaagcaagccgaactggaggagatatatgaaagcagcatccgtggtgtccaactcaga
cgcctctctgccgtcaactccatctttctgagccacaacaacaccaaggaactcaactcc
cccatccttttcgccttctcccaccttgagtcctccgatggggaggcgggaagagaccct
cctgccaaggacgtgatgcctgggccacggcaggagctgctctgtgccttctggaagagt
gacagcgacaggggagggcactgggccaccgagggctgccaggtgctgggcagcaagaac
ggcagcaccacctgccaatgcagccacctgagcagctttgcgatccttatggctcattat
gacgtggaggactggaagctgaccctgatcaccagggtgggactggcgctgtcactcttc
tgcctgctgctgtgcatcctcactttcctgctggtgcggcccatccagggctcgcgcacc
accatacacctgcacctctgcatctgcctcttcgtgggctccaccatcttcctggccggc
atcgagaacgaaggcggccaggtggggctgcgctgccgcctggtggccgggctgctgcac
tactgtttcctggccgccttctgctggatgagcctcgaaggcctggagctctactttctt
gtggtgcgcgtgttccaaggccagggcctgagtacgcgctggctctgcctgatcggctat
ggcgtgcccctgctcatcgtgggcgtctcggctgccatctacagcaagggctacggccgc
cccagatactgctggttggactttgagcagggcttcctctggagcttcttgggacctgtg
accttcatcattttgtgcaatgctgtcattttcgtgactaccgtctggaagctcactcag
aagttttctgaaatcaatccagacatgaagaaattaaagaaggcgagggcgctgaccatc
acggccatcgcgcagctcttcctgttgggctgcacctgggtctttggcctgttcatcttc
gacgatcggagcttggtgctgacctatgtgtttaccatcctcaactgcctgcagggcgcc
ttcctctacctgctgcactgcctgctcaacaagaaggttcgggaagaataccggaagtgg
gcctgcctagttgctggggggagcaagtactcagaattcacctccaccacgtctggcact
ggccacaatcagacccgggccctcagggcatcagagtccggcatatga

DBGET integrated database retrieval system