KEGG   Homo sapiens (human): 9760Help
Entry
9760              CDS       T01001                                 

Gene name
TOX, TOX1
Definition
(RefSeq) thymocyte selection associated high mobility group box
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box HMG_box_2 YABBY
Motif
Other DBs
NCBI-GeneID: 9760
NCBI-ProteinID: NP_055544
OMIM: 606863
HGNC: 18988
Ensembl: ENSG00000198846
Vega: OTTHUMG00000164331
Pharos: O94900(Tbio)
UniProt: O94900
Position
8q12.1
AA seq 526 aa AA seqDB search
MDVRFYPPPAQPAAAPDAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPG
PSLESEDFNIPPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQNMDLPEITV
SNMLGQDGTLLSNSISVMPDIRNPEGTQYSSHPQMAAMRPRGQPADIRQQPGMMPHGQLT
TINQSQLSAQLGLNMGGSNVPHNSPSPPGSKSATPSPSSSVHEDEGDDTSKINGGEKRPA
SDMGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWD
GLGEEQKQVYKKKTEAAKKEYLKQLAAYRASLVSKSYSEPVDVKTSQPPQLINSKPSVFH
GPSQAHSALYLSSHYHQQPGMNPHLTAMHPSLPRNIAPKPNNQMPVTVSIANMAVSPPPP
LQISPPLHQHLNMQQHQPLTMQQPLGNQLPMQVQSALHSPTMQQGFTLQPDYQTIINPTS
TAAQVVTQAMEYVRSGCRNPPPQPVDWNNDYCSSGGMQRDKALYLT
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggacgtaagattttatccacctccagcccagcccgccgctgcgcccgacgctccctgt
ctgggaccttctccctgcctggacccctactattgcaacaagtttgacggtgagaacatg
tatatgagcatgacagagccgagccaggactatgtgccagccagccagtcctaccctggt
ccaagcctggaaagtgaagacttcaacattccaccaattactcctccttccctcccagac
cactcgctggtgcacctgaatgaagttgagtctggttaccattctctgtgtcaccccatg
aaccataatggcctgctaccatttcatccacaaaacatggacctccctgaaatcacagtc
tccaatatgctgggccaggatggaacactgctttctaattccatttctgtgatgccagat
atacgaaacccagaaggaactcagtacagttcccatcctcagatggcagccatgagacca
aggggccagcctgcagacatcaggcagcagccaggaatgatgccacatggccagctgact
accattaaccagtcacagctaagtgctcaacttggtttgaatatgggaggaagcaatgtt
ccccacaactcaccatctccacctggaagcaagtctgcaactccttcaccatccagttca
gtgcatgaagatgaaggcgatgatacctctaagatcaatggtggagagaagcggcctgcc
tctgatatggggaaaaaaccaaaaactcccaaaaagaagaagaagaaggatcccaatgag
ccccagaagcctgtgtctgcctatgcgttattctttcgtgatactcaggccgccatcaag
ggccaaaatccaaacgctacctttggcgaagtctctaaaattgtggcttcaatgtgggac
ggtttaggagaagagcaaaaacaggtctataaaaagaaaaccgaggctgcgaagaaggag
tacctgaagcaactcgcagcatacagagccagccttgtatccaagagctacagtgaacct
gttgacgtgaagacatctcaacctcctcagctgatcaattcgaagccgtcggtgttccat
gggcccagccaggcccactcggccctgtacctaagttcccactatcaccaacaaccggga
atgaatcctcacctaactgccatgcatcctagtctccccaggaacatagcccccaagccg
aataaccaaatgccagtgactgtctctatagcaaacatggctgtgtcccctcctcctccc
ctccagatcagcccgcctcttcaccagcatctcaacatgcagcagcaccagccgctcacc
atgcagcagccccttgggaaccagctccccatgcaggtccagtctgccttacactcaccc
accatgcagcaaggatttactcttcaacccgactatcagactattatcaatcctacatct
acagctgcacaagttgtcacccaggcaatggagtatgtgcgttcggggtgcagaaatcct
cccccacaaccggtggactggaataacgactactgcagtagtgggggcatgcagagggac
aaagcactgtaccttacttga

DBGET integrated database retrieval system