KEGG   Homo sapiens (human): 9765Help
Entry
9765              CDS       T01001                                 

Gene name
ZFYVE16, PPP1R69
Definition
(RefSeq) zinc finger FYVE-type containing 16
  KO
K04679  MAD, mothers against decapentaplegic interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    9765 (ZFYVE16)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9765 (ZFYVE16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    9765 (ZFYVE16)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     9765 (ZFYVE16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYVE
Motif
Other DBs
NCBI-GeneID: 9765
NCBI-ProteinID: NP_001271166
OMIM: 608880
HGNC: 20756
Ensembl: ENSG00000039319
Vega: OTTHUMG00000108178
Pharos: Q7Z3T8(Tbio)
UniProt: Q7Z3T8
Structure
PDB: 

Position
5q14.1
AA seq 809 aa AA seqDB search
MDSYFKAAVSDLDKLLDDFEQNPDEQDYLQDVQNAYDSNHCSVSSELASSQRTSLLPKDQ
ECVNSCASSETSYGTNESSLNEKTLKGLTSIQNEKNVTGLDLLSSVDGGTSDEIQPLYMG
RCSKPICDLISDMGNLVHATNSEEDIKKLLPDDFKSNADSLIGLDLSSVSDTPCVSSTDH
DSDTVREQQNDISSELQNREIGGIKELGIKVDTTLSDSYNYSGTENLKDKKIFNQLESIV
DFNMSSALTRQSSKMFHAKDKLQHKSQPCGLLKDVGLVKEEVDVAVITAAECLKEEGKTS
ALTCSLPKNEDLCLNDSNSRDENFKLPDFSFQEDKTVIKQSAQEDSKSLDLKDNDVIQDS
SSALHVSSKDVPSSLSCLPASGSMCGSLIESKARGDFLPQHEHKDNIQDAVTIHEEIQNS
VVLGGEPFKENDLLKQEKCKSILLQSLIEGMEDRKIDPDQTVIRAESLDGGDTSSTVVES
QEGLSGTHVPESSDCCEGFINTFSSNDMDGQDLDYFNIDEGAKSGPLISDAELDAFLTEQ
YLQTTNIKSFEENVNDSKSQMNQIDMKGLDDGNINNIYFNAEAGAIGESHGINIICETVD
KQNTIENGLSLGEKSTIPVQQGLPTSKSEITNQLSVSDINSQSVGGARPKQLFSLPSRTR
SSKDLNKPDVPDTIESEPSTADTVVPITCAIDSTADPQVSFNSNYIDIESNSEGGSSFVT
ANEDSVPENTCKEGLVLGQKQPTWVPDSEAPNCMNCQVKFTFTKRRHHCRACGKVFCGVC
CNRKCKLQYLEKEARVCVVCYETISKGEY
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atggacagttattttaaagcagctgtcagtgacttggacaaactccttgatgattttgaa
cagaacccagatgaacaagattatctccaagatgtacaaaatgcatatgattctaaccac
tgctcagtttcttcagagttggcttcctcacagcgaacttcattgctcccaaaagaccaa
gagtgcgttaatagttgtgcctcatcagaaacaagctatggaacaaatgagagttccctg
aatgaaaaaacactcaagggacttacttctatacaaaatgaaaaaaatgtaacaggactt
gatcttctttcttctgtggatggtggtacttcagatgaaatccagccgttatatatggga
cgatgtagtaaacctatctgtgatctgataagtgacatgggtaacttagttcatgcaacc
aatagtgaagaagatattaaaaaattattgccagatgattttaagtctaatgcagattcc
ttgattggattggatttatcttcagtgtcagatactccctgtgtttcttcaacagaccat
gatagtgatactgtcagagaacaacagaatgatatcagttctgaattacaaaatagagaa
atcggaggaatcaaagaattgggtataaaagtagatacaacactttcagattcctataat
tacagtggaacagaaaatttaaaagataaaaagatctttaatcagttagaatcaattgtt
gattttaacatgtcatctgctttgactcgacaaagttccaaaatgtttcatgccaaagac
aagctacaacacaagagccagccatgtggattactaaaagatgttggcttagtaaaagag
gaagtagatgtggcagtcataactgccgcagaatgtttaaaagaagagggcaagacaagt
gctttgacctgcagccttccgaaaaatgaagatttatgcttaaatgattcaaattcaaga
gatgaaaatttcaaattacctgacttttcctttcaggaagataagactgttataaaacaa
tctgcacaagaagactcaaaaagtttagaccttaaggataatgatgtaatccaagattcc
tcttcagctttacatgtttccagtaaagatgtgccgtcctcattgtcctgtcttcctgcg
tctgggtctatgtgtggatcattaattgaaagtaaagcacggggtgattttttacctcag
catgaacataaagataatatacaagatgcagtgactatacatgaagaaatacagaacagt
gttgttctaggtggggaaccattcaaagagaatgatcttttgaaacaggaaaaatgtaaa
agcatactccttcagtcattaattgaagggatggaagacagaaagatagatcctgaccag
acagtaatcagagctgagtctttggatggtggtgacaccagttctacagttgtagaatct
caagaggggctttctggcactcatgtcccagagtcttctgattgttgtgaaggttttatt
aatactttttcaagcaatgatatggatgggcaagacttagattactttaatattgatgaa
ggcgcaaaaagtggcccactaattagtgatgctgaacttgatgcctttctgacagaacag
tatcttcagaccactaacataaagtcttttgaagaaaatgtaaatgactctaaatcgcaa
atgaatcagatagatatgaaaggcttagatgatggaaacatcaataatatatatttcaat
gcagaagcaggagctattggggaaagtcatggtattaatataatttgtgaaacagttgat
aaacaaaatacaatagaaaatggcctttctttaggagaaaaaagcactattccagttcaa
caagggttacctaccagtaagtctgagattacaaatcaattatcagtctctgatattaac
agtcaatctgttggaggggccagacctaagcaattgtttagccttccatcaagaacaagg
agttcaaaggacctgaataagccagatgttccagatacaatagaaagtgaacccagcaca
gcagataccgttgttccaatcacttgtgctatagattctacagctgatccacaggttagc
ttcaactctaattacattgatatagaaagtaattctgaaggtggatctagtttcgtaact
gcaaatgaagattctgtacctgaaaacacttgcaaagaaggcttggttttgggccagaaa
cagcctacttgggttcctgattcagaagctccaaactgtatgaactgccaagtcaaattt
acttttaccaaacggcgacaccattgccgagcatgtgggaaagtattttgtggtgtctgt
tgtaataggaagtgtaaactgcaatatctagaaaaggaagcaagagtatgtgtagtctgc
tatgaaactattagtaaaggtgagtattaa

DBGET integrated database retrieval system