KEGG   Homo sapiens (human): 9767
Entry
9767              CDS       T01001                                 

Gene name
JADE3, JADE-3, PHF16
Definition
(RefSeq) jade family PHD finger 3
  KO
K22156  protein Jade-3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9767 (JADE3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    HBO1 complex
     9767 (JADE3)
SSDB
Motif
Pfam: zf-HC5HC2H_2 zf-HC5HC2H PHD_2 PHD EPL1 LZ3wCH C1_1 Prok-RING_1
Other DBs
NCBI-GeneID: 9767
NCBI-ProteinID: NP_001070913
OMIM: 300618
HGNC: 22982
Ensembl: ENSG00000102221
Vega: OTTHUMG00000021431
Pharos: Q92613(Tbio)
UniProt: Q92613 A0A024R1A2
Position
Xp11.3
AA seq 823 aa
MKRHRPVSSSDSSDESPSTSFTSGSMYRIKSKIPNEHKKPAEVFRKDLISAMKLPDSHHI
NPDSYYLFADTWKEEWEKGVQVPASPDTVPQPSLRIIAEKVKDVLFIRPRKYIHCSSPDT
TEPGYINIMELAASVCRYDLDDMDIFWLQELNEDLAEMGCGPVDENLMEKTVEVLERHCH
ENMNHAIETEEGLGIEYDEDVICDVCRSPDSEEGNDMVFCDKCNVCVHQACYGILKVPEG
SWLCRSCVLGIYPQCVLCPKKGGALKTTKTGTKWAHVSCALWIPEVSIACPERMEPITKI
SHIPPSRWALVCNLCKLKTGACIQCSIKSCITAFHVTCAFEHGLEMKTILDEGDEVKFKS
YCLKHSQNRQKLGEAEYPHHRAKEQSQAKSEKTSLRAQKLRELEEEFYSLVRVEDVAAEL
GMPTLAVDFIYNYWKLKRKSNFNKPLFPPKEDEENGLVQPKEESIHTRMRMFMHLRQDLE
RVRNLCYMISRREKLKLSHNKIQEQIFGLQVQLLNQEIDAGLPLTNALENSLFYPPPRIT
LKLKMPKSTPEDHRNSSTETDQQPHSPDSSSSVHSIRNMQVPQESLEMRTKSYPRYPLES
KNNRLLASLSHSRSEAKESSPAWRTPSSECYHGQSLGKPLVLQAALHGQSSIGNGKSQPN
SKFAKSNGLEGSWSGNVTQKDSSSEMFCDQEPVFSPHLVSQGSFRKSTVEHFSRSFKETT
NRWVKNTEDLQCYVKPTKNMSPKEQFWGRQVLRRSAGRAPYQENDGYCPDLELSDSEAES
DGNKEKVRVRKDSSDRENPPHDSRRDCHGKSKTHPLSHSSMQR
NT seq 2472 nt   +upstreamnt  +downstreamnt
atgaaacgccataggcctgtcagcagcagtgacagttcagacgaaagtccttccacttcc
tttacttctggctcaatgtataggatcaagtcaaaaattccaaatgaacacaagaaacct
gctgaggtattccggaaggacctcatcagtgccatgaaacttccagattctcaccacatt
aatcctgatagctattacctctttgctgatacatggaaggaagaatgggaaaagggagtc
caggtaccagccagtccagacaccgttccacagccttctctcaggattatagctgagaag
gtaaaggacgttctgtttatccgaccccggaagtatattcactgctccagcccagacacc
acagagcctggctacatcaacatcatggagttggcagcatctgtttgccgctatgaccta
gatgacatggacatcttctggcttcaggaactcaatgaagaccttgcagaaatgggttgt
gggccagttgatgagaatcttatggaaaagacagtagaagtcctggaacgccattgccat
gaaaatatgaaccatgctattgagacagaggaagggctaggcatagagtatgatgaagat
gtgatctgtgatgtgtgccggtctccagacagtgaagaagggaatgatatggtgttctgt
gataagtgtaacgtctgtgtgcatcaggcctgctatggcatcctcaaggtcccagaaggc
agctggctgtgtcgctcctgtgtcctgggcatttatccgcaatgtgtgttatgtccaaag
aaaggtggagccctgaagaccaccaagacagggactaaatgggctcatgtcagctgtgcc
ctgtggatcccagaggtcagcattgcttgtcctgagaggatggaaccgatcacgaagatc
tcccacatcccacccagtcggtgggccttagtctgcaacttgtgcaagttgaagacgggg
gcttgtattcagtgctctataaaaagctgcatcactgccttccacgtcacctgtgccttt
gagcacggcctagagatgaagaccatcctagatgagggagacgaagtgaagttcaagtca
tattgcctcaagcatagccaaaacaggcagaaacttggagaagctgagtacccccaccac
agggctaaagagcagagccaggccaaaagtgagaaaaccagcctgcgggcacagaagctt
cgggagctggaggaggagttctattccttggtacgagtggaagatgtggccgcagagctg
ggtatgcccacgctagctgtggactttatctataactactggaaactgaagcggaaaagt
aacttcaataagccattatttcctccaaaggaggatgaagaaaatgggctggtgcagcca
aaagaggaaagcattcacactcgaatgagaatgtttatgcatctacgccaggacctggag
agggtccgaaatctgtgctatatgataagcagacgagagaagctgaagctgtcacacaac
aaaatacaggaacagatcttcggtttgcaagtccagcttcttaaccaagaaattgatgca
gggcttcctttgacaaatgcacttgaaaactcactgttttacccaccaccaagaattacc
ttgaagttaaaaatgcccaaatcaaccccagaagaccacagaaacagctccacagaaacc
gatcagcagccccactctcctgacagcagctcatctgttcacagtataaggaacatgcag
gtgcctcaggagtcactagaaatgagaacaaaatcgtatccgagatacccactagagagc
aagaataaccgtttgctggccagtctcagccattctaggagtgaagcaaaggagtccagt
cctgcttggagaaccccgtcctcggagtgctatcatgggcagtcactgggaaagcctctg
gtccttcaggctgccctccatggacagtcttccattgggaatgggaaaagtcagcctaac
tccaagtttgccaaatccaatggcctggagggcagctggtctgggaatgtcacccaaaaa
gacagctcgagtgagatgttctgtgaccaggagcctgtgttcagcccccacttggtcagt
cagggcagctttagaaaatccactgtagaacactttagtaggtcctttaaagagaccacc
aataggtgggtgaagaacacagaggacctccagtgctatgtgaagccaaccaagaatatg
agccccaaggagcagttctggggtagacaggttctcaggcggtctgcagggagagctcca
tatcaggaaaatgatggctattgcccagatttggagctgagtgattcagaggcagaaagt
gatgggaataaagaaaaagtcagggtaaggaaagatagctcagacagggaaaatcctccc
catgactctagacgggattgccatggtaaaagcaagacacatcccctttcccacagttca
atgcaaaggtga

DBGET integrated database retrieval system