KEGG   Homo sapiens (human): 9776
Entry
9776              CDS       T01001                                 

Gene name
ATG13, KIAA0652, PARATARG8
Definition
(RefSeq) autophagy related 13
  KO
K08331  autophagy-related protein 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04211  Longevity regulating pathway
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06128  Autophagy (viruses and bacteria)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
nt06413  Autophagy
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
nt06464  Amyotrophic lateral sclerosis
  Element
N00155  Autophagy-vesicle nucleation
N01142  C9orf72-mediated autophagy initiation
N01143  Mutation-inactivated C9orf72 to C9orf72-mediated autophagy initiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    9776 (ATG13)
   04136 Autophagy - other
    9776 (ATG13)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    9776 (ATG13)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    9776 (ATG13)
   05014 Amyotrophic lateral sclerosis
    9776 (ATG13)
   05016 Huntington disease
    9776 (ATG13)
   05017 Spinocerebellar ataxia
    9776 (ATG13)
   05022 Pathways of neurodegeneration - multiple diseases
    9776 (ATG13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9776 (ATG13)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    9776 (ATG13)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    9776 (ATG13)
   Atg1 complex
    9776 (ATG13)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    9776 (ATG13)
SSDB
Motif
Pfam: ATG13
Other DBs
NCBI-GeneID: 9776
NCBI-ProteinID: NP_001136145
OMIM: 615088
HGNC: 29091
Ensembl: ENSG00000175224
Vega: OTTHUMG00000166538
Pharos: O75143(Tbio)
UniProt: O75143 A8K0S6
Structure
PDB: 

Position
11p11.2
AA seq 517 aa
METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPE
VTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNR
LSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPV
GTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGV
IYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQ
LMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRA
SPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETE
SPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLS
IDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggaaactgatctcaattcccaggacagaaaggacctggacaagtttattaaatttttt
gccctcaagactgtccaagtgattgtccaggctcggcttggtgaaaagatttgcactcgt
tcatcatcttctccaacgggttcagattggttcaacttagcaatcaaagacatcccagag
gttacacatgaagcaaagaaggcactggcaggacagctgcctgcagtcgggaggtccatg
tgtgtggagatttcacttaagacttctgagggagattccatggagctggaaatatggtgt
cttgaaatgaatgaaaagtgtgataaagaaatcaaagtttcctacacggtgtacaacaga
ctgtcattgctgctgaagtcccttcttgctataactagggtgacaccagcctataggctc
tccaggaaacaagggcatgaatatgtcatattatacaggatatattttggagaagttcag
ctgagtggcttaggagaaggcttccagacagttcgtgttgggacagtgggcacccctgtg
ggcaccatcactctttcttgtgcttacagaattaacttggcattcatgtctaccaggcaa
tttgagaggaccccacctatcatggggattattattgatcactttgtggaccgtccctat
cccagctcctctcccatgcacccctgcaattacagaactgctggtgaggacactggagta
atatacccgtctgtagaagactctcaagaagtgtgtaccacctctttttccacctcccca
ccatcccagctctcaagctctcgcctttcctatcagcctgctgccctgggcgttggatca
gctgacctggcttatccagtagtgtttgctgctggcttaaatgctacacaccctcaccag
ctgatggttcctgggaaggaaggtggggtaccccttgctcccaaccagcctgtccatggt
acccaggctgaccaggagagactggcaacctgcaccccttctgacagaacccactgtgct
gccacaccctccagtagtgaggatactgaaaccgtatcaaacagcagtgagggacgggcc
tcccctcacgatgtcttggagaccatctttgtccgaaaagtgggggcttttgtcaacaaa
cccattaaccaggtgaccctgacgagtttggatataccctttgccatgtttgctcccaag
aatttggagctggaggataccgatccaatggtgaatcctccagattccccagagactgaa
tctcctctccagggcagcctgcactcagatggctccagcgggggcagcagtggcaatacc
catgatgactttgttatgatagactttaaaccagctttttctaaagatgacattcttccg
atggacctggggaccttctatcgggagtttcagaacccacctcagctgagcagcctctcc
atagatattggagcacagtccatggctgaagacttggactcattaccagagaagctggct
gtgcatgagaagaatgtccgcgagtttgatgcctttgtggaaaccctgcagtaa

DBGET integrated database retrieval system