KEGG   Homo sapiens (human): 9782Help
Entry
9782              CDS       T01001                                 

Gene name
MATR3, ALS21, MPD2, VCPDM
Definition
(RefSeq) matrin 3
  KO
K13213  matrin 3
Organism
hsa  Homo sapiens (human)
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    9782 (MATR3)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    9782 (MATR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_5 zf-C2H2_jaz Utp14
Motif
Other DBs
NCBI-GeneID: 9782
NCBI-ProteinID: NP_001181883
OMIM: 164015
HGNC: 6912
Ensembl: ENSG00000015479 ENSG00000280987
Vega: OTTHUMG00000129229 OTTHUMG00000189583
Pharos: P43243(Tbio)
UniProt: P43243 A0A0R4J2E8
Position
5q31.2
AA seq 847 aa AA seqDB search
MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTARLASLMNLGM
SSSLNQQGAHSALSSASTSSHNLQSIFNIGSRGPLPLSSQHRGDADQASNILASFGLSAR
DLDELSRYPEDKITPENLPQILLQLKRRRTEEGPTLSYGRDGRSATREPPYRVPRDDWEE
KRHFRRDSFDDRGPSLNPVLDYDHGSRSQESGYYDRMDYEDDRLRDGERCRDDSFFGETS
HNYHKFDSEYERMGRGPGPLQERSLFEKKRGAPPSSNIEDFHGLLPKGYPHLCSICDLPV
HSNKEWSQHINGASHSRRCQLLLEIYPEWNPDNDTGHTMGDPFMLQQSTNPAPGILGPPP
PSFHLGGPAVGPRGNLGAGNGNLQGPRHMQKGRVETSRVVHIMDFQRGKNLRYQLLQLVE
PFGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPALVFGKPVRVHLSQKYKRIKKP
EGKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEME
TREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLVLRIPNRGIDLLKKDKSRKRSYSPD
GKESPSDKKSKTDGSQKTESSTEGKEQEEKSGEDGEKDTKDDQTEQEPNMLLESEDELLV
DEEEAAALLESGSSVGDETDLANLGDVASDGKKEPSDKAVKKDGSASAAAKKKLKKVDKI
EELDQENEAALENGIKNEENTEPGAESSENADDPNKDTSENADGQSDENKDDYTIPDEYR
IGPYQPNVPVGIDYVIPKTGFYCKLCSLFYTNEEVAKNTHCSSLPHYQKLKKFLNKLAEE
RRQKKET
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagtcattccagcagtcatctctcagtagggactcacagggtcatgggcgtgac
ctgtctgcggcaggaataggccttcttgctgctgctacccagtctttaagtatgccagca
tctcttggaaggatgaaccagggtactgcacgccttgctagtttaatgaatcttggaatg
agttcttcattgaatcaacaaggagctcatagtgcactgtcttctgctagtacttcttcc
cataatttgcagtctatatttaacattggaagtagaggtccactccctttatcttctcaa
caccgtggagatgcagaccaggccagtaacattttggccagctttggtctgtctgctaga
gacttagatgaactgagtcgttatccagaggacaagattactcctgagaatttgccccaa
atccttctacagcttaaaaggaggagaactgaagaaggccctaccttgagttatggtaga
gatggcagatctgctacacgggagccaccatacagagtacctagggatgattgggaagaa
aaaaggcactttagaagagatagttttgatgatcgtggtcctagtctcaacccagtgctt
gattatgaccatggaagtcgttctcaagaatctggttattatgacagaatggattatgaa
gatgacagattaagagatggagaaaggtgtagggatgattctttttttggtgagacctcg
cataactatcataaatttgacagtgagtatgagagaatgggacgtggtcctggcccctta
caagagagatctctctttgagaaaaagagaggcgctcctccaagtagcaatattgaagac
ttccatggactcttaccgaagggttatccccatctgtgctctatatgtgatttgccagtt
cattctaataaggagtggagtcaacatatcaatggagcaagtcacagtcgtcgatgccag
cttcttcttgaaatctacccagaatggaatcctgacaatgatacaggacacacaatgggt
gatccattcatgttgcagcagtctacaaatccagcaccaggaattctgggacctccacct
ccctcatttcatcttgggggaccagcagttggaccaagaggaaatctgggtgctggaaat
ggaaacctgcaaggacctagacacatgcagaaaggcagagtggaaactagcagagttgtt
cacatcatggattttcaacgagggaaaaacttgagataccagctattacagctggtagaa
ccatttggagtcatttcaaatcatctgattctaaataaaattaatgaggcatttattgaa
atggcaaccacagaggatgctcaggccgcagtggattattacacaaccacaccagcgtta
gtatttggcaagccagtgagagttcatttatcccagaagtataaaagaataaagaaacct
gaaggaaagccagatcagaagtttgatcaaaagcaagagcttggacgtgtgatacatctc
agcaatttgccgcattctggctattctgatagtgctgttctcaagcttgctgagccttat
gggaaaataaagaattacatattgatgaggatgaaaagtcaggcttttattgagatggag
acaagagaagatgcaatggcaatggttgaccattgtttgaaaaaagccctttggtttcag
gggagatgtgtgaaggttgacctgtctgagaaatataaaaaactggttctgaggattcca
aacagaggcattgatttactgaaaaaagataaatcccgaaaaagatcttactctccagat
ggcaaagaatctccaagtgataagaaatccaaaactgatggttcccagaagactgagagt
tcaaccgaaggtaaagaacaagaagagaagtccggtgaagatggtgagaaagacacaaag
gatgaccagacagagcaggaacctaatatgcttcttgaatctgaagatgagctacttgta
gatgaagaagaagcagcagcactgctagaaagtggcagttcagtgggagacgagaccgat
cttgctaatttaggtgatgtggcttctgatgggaaaaaggaaccatcagataaagctgtg
aaaaaagatggaagtgcttcagcagcagcaaagaaaaagcttaaaaaggtggacaagatc
gaggaacttgatcaagaaaacgaagcagcgttggaaaatggaattaaaaatgaggaaaac
acagaaccaggtgctgaatcttctgagaacgctgatgatcccaacaaagatacaagtgaa
aacgcagatggtcaaagtgatgagaacaaggacgactatacaatcccagatgagtataga
attggaccatatcagcccaatgttcctgttggtatagactatgtgatacctaaaacaggg
ttttactgtaagctgtgttcactcttttatacaaatgaagaagttgcaaagaatactcat
tgcagcagccttcctcattatcagaaattaaagaaatttctgaataaattggcagaagaa
cgcagacagaagaaggaaacttaa

DBGET integrated database retrieval system