KEGG   Homo sapiens (human): 9793
Entry
9793              CDS       T01001                                 
Symbol
CKAP5, CHTOG, MSPS, TOG, TOGp, ch-TOG
Name
(RefSeq) cytoskeleton associated protein 5
  KO
K16803  cytoskeleton-associated protein 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9793 (CKAP5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    9793 (CKAP5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    9793 (CKAP5)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    XMAP215
     9793 (CKAP5)
SSDB
Motif
Pfam: CLASP_N HEAT HEAT_2 Cnd1 TAN Cohesin_HEAT DUF1071
Other DBs
NCBI-GeneID: 9793
NCBI-ProteinID: NP_001008938
OMIM: 611142
HGNC: 28959
Ensembl: ENSG00000175216
Pharos: Q14008(Tbio)
UniProt: Q14008
Structure
Position
11:complement(46743048..46846280)
AA seq 2032 aa
MGDDSEWLKLPVDQKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDS
NAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIE
KGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAV
RDEAKLIAVEIYRWIRDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEA
KLEQQQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEAL
ESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAG
HVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFI
ARSFRHCTASTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKAVNPFLA
DVDKLKLDKIKECSEKVELIHGKKAGLAADKKEFKPLPGRTAASGAAGDKDTKDISAPKP
GPLKKAPAAKAGGPPKKGKPAAPGGAGNTGTKNKKGLETKEIVEPELSIEVCEEKASAVL
PPTCIQLLDSSNWKERLACMEEFQKAVELMDRTEMPCQALVRMLAKKPGWKETNFQVMQM
KLHIVALIAQKGNFSKTSAQVVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQVV
SMAFSQKNPKNQSETLNWLSNAIKEFGFSGLNVKAFISNVKTALAATNPAVRTAAITLLG
VMYLYVGPSLRMFFEDEKPALLSQIDAEFEKMQGQSPPAPTRGISKHSTSGTDEGEDGDE
PDDGSNDVVDLLPRTEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINDAKFIQPNIGE
LPTALKGRLNDSNKILVQQTLNILQQLAVAMGPNIKQHVKNLGIPIITVLGDSKNNVRAA
ALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLAEKLPTLRSTPTDLILCV
PHLYSCLEDRNGDVRKKAQDALPFFMMHLGYEKMAKATGKLKPTSKDQVLAMLEKAKVNM
PAKPAPPTKATSKPMGGSAPAKFQPASAPAEDCISSSTEPKPDPKKAKAPGLSSKAKSAQ
GKKMPSKTSLKEDEDKSGPIFIVVPNGKEQRMKDEKGLKVLKWNFTTPRDEYIEQLKTQM
SSCVAKWLQDEMFHSDFQHHNKALAVMVDHLESEKEGVIGCLDLILKWLTLRFFDTNTSV
LMKALEYLKLLFTLLSEEEYHLTENEASSFIPYLVVKVGEPKDVIRKDVRAILNRMCLVY
PASKMFPFIMEGTKSKNSKQRAECLEELGCLVESYGMNVCQPTPGKALKEIAVHIGDRDN
AVRNAALNTIVTVYNVHGDQVFKLIGNLSEKDMSMLEERIKRSAKRPSAAPIKQVEEKPQ
RAQNISSNANMLRKGPAEDMSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRC
EMPELVQHKLDDIFEPVLIPEPKIRAVSPHFDDMHSNTASTINFIISQVASGDINTSIQA
LTQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLIYNTHMADEKLEKDEIIKLYSCIIGN
MISLFQIESLAREASTGVLKDLMHGLITLMLDSRIEDLEEGQQVIRSVNLLVVKVLEKSD
QTNILSALLVLLQDSLLATASSPKFSELVMKCLWRMVRLLPDTINSINLDRILLDIHIFM
KVFPKEKLKQCKSEFPIRTLKTLLHTLCKLKGPKILDHLTMIDNKNESELEAHLCRMMKH
SMDQTGSKSDKETEKGASRIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKY
SDADIEPFLKNSSQFFQSYVERGLRVIEMEREGKGRISTSTGISPQMEVTCVPTPTSTVS
SIGNTNGEEVGPSVYLERLKILRQRCGLDNTKQDDRPPLTSLLSKPAVPTVASSTDMLHS
KLSQLRESREQHQHSDLDSNQTHSSGTVTSSSSTANIDDLKKRLERIKSSRK
NT seq 6099 nt   +upstreamnt  +downstreamnt
atgggagatgacagtgagtggttgaaactgccagttgatcagaaatgtgaacacaagctg
tggaaagcaaggttaagtgggtatgaagaggccctgaagatcttccagaaaataaaggat
gaaaagagcccagagtggtccaaatttttaggattgatcaaaaaatttgtcactgattcc
aatgcagtggttcaattgaaaggattagaagctgcacttgtttatgttgaaaatgcccat
gtagcaggaaaaaccacaggagaagttgtgtcaggtgttgtaagtaaggtgttcaatcaa
cctaaagctaaagccaaggagctgggcatagagatctgtcttatgtacatagagattgag
aaaggagaggctgttcaagaagagctcctgaaaggcttggacaataagaatcccaagatc
atagtggcctgtatagagacactgaggaaagccttaagtgaatttggttccaaaatcatc
ttgcttaagccaattatcaaagtgttgccaaaactctttgagtctcgagagaaggctgtt
cgagatgaagccaaactaattgctgtggagatttacagatggattcgggatgctctgaga
cccccattacaaaatataaactctgttcagttgaaagaactagaagaagaatgggtcaaa
ctgccaacaagtgctcctagacctactcgatttcttcgttcccaacaagaactagaagct
aaattggaacaacaacagtctgctggtggagatgctgaaggaggtggtgatgatggtgat
gaggtgccacaaatagatgcttatgagcttttagaagctgtagaaatcctttccaaactt
cccaaagacttttatgacaaaattgaggcaaaaaaatggcaagagagaaaagaggccctg
gagtctgtagaagtactaataaaaaaccccaaactggaagctggcgattatgcagattta
gtaaaagcattaaagaaggttgttggaaaggacaccaatgtcatgttggtggctttggca
gcaaaatgtcttactggcctggctgttgggctaaggaagaaatttggacaatatgcagga
catgttgtgccaaccatcttggagaaattcaaagagaagaaacctcaagtggtacaagcc
ctgcaggaggcaattgatgcaatcttccttactaccacactacagaacatcagtgaggat
gttttagcagtaatggataataaaaatccaaccatcaagcagcagacatctctttttatt
gcaagaagtttccgccactgcactgcttctaccctgccaaagagcttgctaaagcccttt
tgtgctgcactacttaagcacatcaatgattctgctcctgaagtcagagatgccgcattt
gaagcattgggtactgctttgaaggtggttggcgagaaagcagtaaacccattcctagct
gatgtggacaaactcaagcttgataagatcaaagaatgttcagaaaaggtagaactgata
catggtaagaaagctggactagctgctgataagaaggaattcaaacctctgcctggaagg
actgctgcttcaggggctgcaggagataaggacacaaaggacatttctgcacccaaacca
ggacctctaaaaaaggcacctgctgctaaggctggtgggccaccaaaaaaggggaaacca
gctgcaccaggaggcgcagggaatactggaaccaagaacaagaaaggactggagactaaa
gaaatagtggagcctgagctctcgatagaagtatgtgaagaaaaagcttcagctgttctt
ccccctacctgtatacagcttcttgacagcagtaactggaaagaaaggctggcttgtatg
gaagagttccagaaggctgttgagctaatggaccgaactgaaatgccatgccaggcatta
gtgaggatgctagccaagaaacctggatggaaagaaactaattttcaggtgatgcaaatg
aagcttcatatagttgctttgattgcccagaagggaaatttttccaaaacgtcagctcag
gttgtattagatggccttgtggacaagattggagatgtgaaatgtgggaacaatgcaaaa
gaagctatgacagcaatagccgaagcctgtatgttaccatggactgctgaacaggttgtg
tcaatggctttctcacaaaagaatcccaaaaatcagtcagaaactctgaattggctatca
aatgccataaaagaatttggtttttctgggttgaatgtcaaagctttcattagcaatgtg
aagacagctcttgctgcaacaaacccagctgtgaggactgctgccataaccctgcttggc
gtgatgtatctgtatgttggtccctctttgcgaatgttctttgaggatgagaagcctgcc
ctcctatcccagatagatgcagaatttgagaagatgcagggacaaagtccacctgctcca
accagaggaatttccaagcatagcacaagtggtacagatgaaggagaagatggagatgaa
ccagatgacgggagcaatgatgtcgttgatcttttgccgaggacggagatcagtgataaa
atcacttcagagttggtatctaagattggtgataagaattggaagattaggaaagaaggc
ctagatgaagtggcaggtattattaatgacgcaaaatttatccaaccgaatataggtgaa
cttccaactgccttgaagggtcgactcaatgattcaaataaaatcttggtacagcaaacg
ctgaatatcctgcaacaactggcagtagccatgggcccaaatattaagcaacatgtaaaa
aatttaggcatccctatcatcacagtccttggagacagcaagaacaatgttcgagctgct
gccctagcgactgtgaatgcttgggcagaacagactggcatgaaggaatggctggaagga
gaagatctttctgaagagctcaaaaaggaaaatcctttcttgaggcaagagcttctgggc
tggctggctgagaaactacctactcttcgttccacccctacagaccttatcctttgtgtt
cctcatctctactcctgcctagaagatcgaaatggagatgtgcgaaagaaggcccaagat
gccttgccattcttcatgatgcatttaggatatgaaaaaatggccaaggctactgggaaa
ctaaagccaacttctaaagatcaggtattggccatgctagagaaagccaaagttaacatg
ccagccaagcctgctccacccactaaagcaacttctaaaccaatgggagggtccgctcca
gccaaattccagcctgcatcagcacctgctgaagattgtatttccagcagtacagaaccc
aaacctgatccaaaaaaggccaaagctccaggattatcctctaaagcaaagagtgcacaa
gggaagaagatgccaagcaaaaccagcttaaaggaggatgaagacaaatccgggcctatt
tttattgttgttccaaatggaaaagagcaaaggatgaaagatgaaaaaggattgaaggtg
ctaaagtggaattttactaccccacgggatgaatacattgagcaactaaagactcaaatg
tctagctgtgtggctaaatggttacaagatgagatgtttcactcagactttcagcatcat
aacaaagcccttgctgttatggttgatcacttggagagtgaaaaagaaggagttattggt
tgcctggatcttatcttaaagtggcttaccctgaggttttttgacaccaatacaagcgtc
ctgatgaaagcactagaatatttaaaattgctcttcaccttgctaagtgaagaagaatat
catcttactgagaatgaagcatcttccttcatcccctatcttgtcgtcaaggttggagaa
ccaaaggatgtcattcgtaaagatgttcgtgccatcctgaaccggatgtgccttgtctac
ccagctagcaagatgtttccctttatcatggaaggaaccaaatccaaaaactctaagcag
agagcagagtgcctggaagagctgggatgtctggttgagtcctatggcatgaatgtttgc
caaccaaccccaggaaaagccttaaaggaaatagctgttcacataggagaccgtgacaat
gctgtacgcaatgctgcactcaacaccattgtaacggtgtacaatgtacatggggatcag
gtgttcaaactgattggaaatctttctgaaaaggatatgagcatgctcgaggagaggatt
aagcggtcagcaaagagaccctctgctgcaccaataaaacaggtggaagagaaacctcag
cgtgcacagaacataagctccaatgccaacatgttacgcaagggaccagctgaggacatg
tcttccaaactcaaccaagcccgaagcatgagtgggcatcctgaggcagcccagatggtc
cgccgagaattccagctggatctagatgagattgagaatgacaatggtacagtccgatgt
gaaatgccagaacttgttcagcacaaactggatgacatttttgagccagtccttattcct
gaacccaagatccgggctgtttctccacacttcgatgacatgcacagtaatacagcatcc
acaatcaatttcattatctcccaagtagccagtggtgacatcaacacaagtatccaagct
ctgacacagatcgatgaggtcctgagacaggaagacaaagctgaagccatgtccggccat
attgatcagtttctgatagccacttttatgcagctaagactcatctacaacacacacatg
gcagatgagaaattggagaaggacgagatcatcaagttgtatagctgtatcattggcaac
atgatttcgctgtttcagatagagagccttgcccgggaggcctccactggagtactaaaa
gacctaatgcatggcctcatcaccttaatgctggattctcggattgaagatcttgaggaa
ggacaacaggtcatccgctctgtgaacctcttggtggtgaaggttctggagaagtcagac
cagaccaacatcctgagtgccctacttgttttgctccaagacagcctgctagcaacagcc
agttctcccaaattctcagagcttgttatgaagtgtctctggagaatggttcgactgttg
cctgataccatcaatagcattaacctagacagaattcttctggatatccacattttcatg
aaggtcttccccaaagagaaactgaagcaatgcaaaagtgaatttcccataaggacccta
aagaccctgctacacaccttatgcaaattaaaagggcccaagatcctggaccacctaacg
atgatcgacaacaaaaacgagtctgagctggaggcccatctctgccggatgatgaagcac
agtatggaccagactgggagcaagtctgataaggaaacagaaaagggagcatctcgaata
gatgaaaaatcatcaaaggccaaagtgaatgatttcttagctgagatttttaagaagatt
ggctctaaagaaaacactaaagagggactagcagagttatatgaatataagaagaaatac
tcagatgctgacattgaaccatttctgaaaaattcctcacagttcttccagagctatgtc
gaaagaggccttcgggtgattgagatggagagggagggcaaaggtcgtatttccacttca
acaggcatctcccctcagatggaagtcacatgtgtgcccacgcccacaagcacagtgtcc
tccataggtaacacaaatggggaagaagtggggccatctgtctacttggaaaggctaaag
atcctccgacagcgatgtggtctggacaacacaaagcaagatgaccgacctcctttgacc
tctttgctctccaaaccagcagttcctactgtcgcctcttccacagacatgctccacagc
aaactctctcagctccgggagtcacgggagcagcaccagcattcagacctggattctaac
cagactcactcttcaggaactgtgacctcctcctcctccacagctaacatagacgacttg
aaaaaaagactggagagaataaagagcagtcgcaaatga

DBGET integrated database retrieval system