KEGG   Homo sapiens (human): 9794Help
Entry
9794              CDS       T01001                                 

Gene name
MAML1, Mam-1, Mam1
Definition
(RefSeq) mastermind like transcriptional coactivator 1
  KO
K06061  mastermind
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05165  Human papillomavirus infection
Network
N00380  HPV E6 to Notch signaling pathway
N00381  HPV E6 to Notch signaling pathway
N00382  HPV E6 to Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    9794 (MAML1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    9794 (MAML1)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    9794 (MAML1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MamL-1 Kri1
Motif
Other DBs
NCBI-GeneID: 9794
NCBI-ProteinID: NP_055572
OMIM: 605424
HGNC: 13632
Ensembl: ENSG00000161021
Vega: OTTHUMG00000163237
Pharos: Q92585(Tbio)
UniProt: Q92585
Structure
PDB: 

Position
5q35.3
AA seq 1016 aa AA seqDB search
MVLPTCPMAEFALPRHSAVMERLRRRIELCRRHHSTCEARYEAVSPERLELERQHTFALH
QRCIQAKAKRAGKHRQPPAATAPAPAAPAPRLDAADGPEHGRPATHLHDTVKRNLDSATS
PQNGDQQNGYGDLFPGHKKTRREAPLGVAISSNGLPPASPLGQSDKPSGADALQSSGKHS
LGLDSLNKKRLADSSLHLNGGSNPSESFPLSLNKELKQEPVEDLPCMITGTVGSISQSNL
MPDLNLNEQEWKELIEELNRSVPDEDMKDLFNEDFEEKKDPESSGSATQTPLAQDINIKT
EFSPAAFEQEQLGSPQVRAGSAGQTFLGPSSAPVSTDSPSLGGSQTLFHTSGQPRADNPS
PNLMPASAQAQNAQRALAGVVLPSQGPGGASELSSAHQLQQIAAKQKREQMLQNPQQATP
APAPGQMSTWQQTGPSHSSLDVPYPMEKPASPSSYKQDFTNSKLLMMPSVNKSSPRPGGP
YLQPSHVNLLSHQPPSNLNQNSANNQGSVLDYGNTKPLSHYKADCGQGSPGSGQSKPALM
AYLPQQLSHISHEQNSLFLMKPKPGNMPFRSLVPPGQEQNPSSVPVQAQATSVGTQPPAV
SVASSHNSSPYLSSQQQAAVMKQHQLLLDQQKQREQQQKHLQQQQFLQRQQHLLAEQEKQ
QFQRHLTRPPPQYQDPTQGSFPQQVGQFTGSSAAVPGMNTLGPSNSSCPRVFPQAGNLMP
MGPGHASVSSLPTNSGQQDRGVAQFPGSQNMPQSSLYGMASGITQIVAQPPPQATNGHAH
IPRQTNVGQNTSVSAAYGQNSLGSSGLSQQHNKGTLNPGLTKPPVPRVSPAMGGQNSSWQ
HQGMPNLSGQTPGNSNVSPFTAASSFHMQQQAHLKMSSPQFSQAVPNRPMAPMSSAAAVG
SLLPPVSAQQRTSAPAPAPPPTAPQQGLPGLSPAGPELGAFSQSPASQMGGRAGLHCTQA
YPVRTAGQELPFAYSGQPGGSGLSSVAGHTDLIDSLLKNRTSEEWMSDLDDLLGSQ
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgcccacctgccccatggcggagttcgcgctgccgcggcacagcgcggtcatg
gagcgccttcgccggcgcatcgagctgtgccggcgccaccacagcacctgcgaggcccgc
tacgaggccgtgtcgcccgagcgcctggagctggagcgccaacacaccttcgccctgcac
cagcgctgcatccaggccaaggccaagcgcgccgggaagcacaggcagccgcccgccgcc
acggccccggcgcccgccgccccggccccgcgcctggacgccgctgacggccccgagcac
ggccgcccggccacgcatcttcatgatacagttaagaggaatcttgacagcgccacttcc
cctcagaatggcgatcaacagaatggctacggggacctctttcctgggcataagaagact
cgccgggaggcccctctgggagttgccatctcttccaatggactgcctccagcctccccc
ctcggtcagtctgacaagccttctggagccgacgccctgcagtccagtgggaagcactct
ctggggctagactctctcaacaaaaagcgtctggctgactccagccttcacttgaatgga
ggcagtaaccccagtgagtcatttcctctgagcctgaataaagaactgaagcaggagcct
gtcgaagacctgccttgcatgatcactgggactgtcggctccatatcgcaaagcaacctc
atgccagacctcaaccttaacgagcaggagtggaaggagctcatcgaggagctgaacagg
tcggtgcccgatgaagacatgaaggacctgtttaatgaggacttcgaggagaagaaggac
ccagagtcttctggctctgccacacaaacccccttggcacaggacattaatattaagacg
gaattctctccagcagcctttgagcaagaacagttaggctctccacaagtgagggccggg
tctgcagggcagacctttctggggccttcctctgcccctgtgagtacagattcccccagc
ctagggggctcccaaaccttattccacacctctggtcagccccgggcggacaatcccagt
ccaaacctgatgccggcatcagcccaggcccagaacgcacaaagagcccttgcaggtgtg
gtattgcccagtcagggcccaggaggggcctcagagctgtcctctgcccaccagctccag
cagatcgctgccaagcagaagcgcgagcagatgctccagaacccacagcaggccaccccg
gcaccagccccgggccagatgtccacatggcagcagacggggccctcccacagttcctta
gatgtcccttaccccatggagaagcctgccagcccttccagctacaagcaagacttcact
aactccaaactgctcatgatgcctagtgtgaataagagttcccctcggcccggaggcccc
tacctccagcccagccatgtgaacctgctgagtcaccagccaccgagtaacttgaatcag
aactccgcgaataaccaggggtctgtgctggactacggcaatacaaaacccctttctcat
tacaaagcggactgtgggcaaggcagcccggggtctggccagagcaagccagccctgatg
gcttatcttccccagcagctgtcccatataagtcacgagcagaactccctgtttctgatg
aagccaaagccaggaaatatgcctttccgatcactggttccacctggccaggagcagaac
ccttccagtgtccctgtgcaagcccaggctaccagtgttgggacccagccgcctgccgtg
tccgtggccagctcccacaacagctccccctatctcagcagccagcaacaggccgctgta
atgaagcagcatcagttgcttttggaccaacagaaacaaagggagcagcagcaaaagcat
ttacagcaacagcagttccttcagaggcaacagcaccttctcgcggaacaggagaagcaa
cagtttcagcgccatctgacccgcccaccaccccagtaccaagacccgacacaaggcagc
ttcccacagcaggttggacagttcacagggtcctctgctgccgtgcccggcatgaacacc
ttgggtccatccaactccagctgtcctcgagtgttccctcaggctgggaatctgatgcca
atgggccctggacatgcttcagtttcctctctccccacaaactcaggccaacaggaccgg
ggtgtggctcagttccctggctcccaaaacatgcctcagagcagcctctatggcatggct
tctggcataacccagatagttgcccagcccccgccacaggccaccaatggacatgcccac
attccacggcagaccaacgtgggccagaacacctccgtctcagctgcctatgggcagaac
tctctgggaagctctggcctctcccagcagcacaataaggggaccctgaaccctggttta
acaaagccaccggtcccaagggtgtcaccagccatgggaggccagaattcctcctggcag
catcagggaatgccgaacctcagtggccagaccccagggaacagcaacgtgagtcccttc
actgcagcctccagtttccacatgcagcagcaggcccacctgaaaatgtctagcccgcaa
ttctcccaggcagtgcccaacaggcccatggctcccatgagctcagcagctgccgtgggg
tccttgctacccccagtgagtgcacagcagaggaccagcgcccctgccccagcaccaccc
ccaacagcccctcagcagggcttgcctggcctgagcccagcagggcctgagctgggggcc
ttcagccagagccctgcctcacagatgggcggtcgggcggggctgcactgcacccaggcc
taccctgtgcggaccgcgggccaggagctgccttttgcctatagcgggcagccaggtggc
agtgggctctctagtgtggctggacacaccgatctgatcgactccctgctgaagaacagg
acttcagaggagtggatgagtgatttggacgacctgttagggtctcagtaa

DBGET integrated database retrieval system