KEGG   Homo sapiens (human): 98
Entry
98                CDS       T01001                                 
Symbol
ACYP2, ACYM, ACYP
Name
(RefSeq) acylphosphatase 2
  KO
K01512  acylphosphatase [EC:3.6.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    98 (ACYP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.7  acylphosphatase
     98 (ACYP2)
SSDB
Motif
Pfam: Acylphosphatase
Other DBs
NCBI-GeneID: 98
NCBI-ProteinID: NP_612457
OMIM: 102595
HGNC: 180
Ensembl: ENSG00000170634
Pharos: P14621(Tbio)
UniProt: P14621 A0A140VJD7
Position
2:53971113..54305300
AA seq 99 aa
MSTAQSLKSVDYEVFGRVQGVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVN
SMKSWLSKVGSPSSRIDRTNFSNEKTISKLEYSNFSIRY
NT seq 300 nt   +upstreamnt  +downstreamnt
atgtctaccgcccagtcactcaaatccgtggactacgaggtgttcggaagagtgcagggt
gtttgcttcagaatgtatacagaagatgaagctaggaaaataggagtggttggctgggtg
aagaataccagcaaaggcaccgtgacaggccaagtgcaggggccagaagacaaagtcaat
tccatgaagtcctggctgagcaaggttggaagccctagttctcgcattgaccgcacaaac
ttttctaatgaaaaaaccatctctaagcttgaatactctaattttagtattagatactaa

DBGET integrated database retrieval system