KEGG   Homo sapiens (human): 9804
Entry
9804              CDS       T01001                                 
Symbol
TOMM20, MAS20, MOM19, TOM20
Name
(RefSeq) translocase of outer mitochondrial membrane 20
  KO
K17770  mitochondrial import receptor subunit TOM20
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    9804 (TOMM20)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9804 (TOMM20)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    9804 (TOMM20)
Transporters [BR:hsa02000]
 Other transporters
  Primary active transporters [TC:3]
   9804 (TOMM20)
SSDB
Motif
Pfam: MAS20 RSN1_7TM TPR_1
Other DBs
NCBI-GeneID: 9804
NCBI-ProteinID: NP_055580
OMIM: 601848
HGNC: 20947
Ensembl: ENSG00000173726
Pharos: Q15388(Tbio)
UniProt: Q15388 A0A024R3W2
Structure
Position
1:complement(235109341..235128837)
AA seq 145 aa
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDL
KDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQ
MLLTKLPTISQRIVSAQSLAEDDVE
NT seq 438 nt   +upstreamnt  +downstreamnt
atggtgggtcggaacagcgccatcgccgccggtgtatgcggggcccttttcattgggtac
tgcatctacttcgaccgcaaaagacgaagtgaccccaacttcaagaacaggcttcgagaa
cgaagaaagaaacagaagcttgccaaggagagagctgggctttccaagttacctgacctt
aaagatgctgaagctgttcagaagttcttccttgaagaaatacagcttggtgaagagtta
ctagctcaaggtgaatatgagaagggcgtagaccatctgacaaatgcaattgctgtgtgt
ggacagccacagcagttactgcaggtcttacagcaaactcttccaccaccagtgttccag
atgcttctgactaagctcccaacaattagtcagagaattgtaagtgctcagagcttggct
gaagatgatgtggaatga

DBGET integrated database retrieval system