KEGG   Homo sapiens (human): 9810Help
Entry
9810              CDS       T01001                                 

Gene name
RNF40, BRE1B, RBP95, STARING
Definition
(RefSeq) ring finger protein 40
  KO
K10696  E3 ubiquitin-protein ligase BRE1 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9810 (RNF40)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     9810 (RNF40)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   BRE1 proteins
    9810 (RNF40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_3 zf-C3HC4 zf-C3HC4_2 zf-RING_5 BRE1 KASH_CCD EzrA zf-RING_2 Prok-RING_4 zf-RING_UBOX zf-rbx1 SpoIIE
Motif
Other DBs
NCBI-GeneID: 9810
NCBI-ProteinID: NP_001273501
OMIM: 607700
HGNC: 16867
Ensembl: ENSG00000103549
Vega: OTTHUMG00000132394
Pharos: O75150(Tbio)
UniProt: O75150
Position
16p11.2
AA seq 1001 aa AA seqDB search
MSGPGNKRAAGDGGSGPPEKKLSREEKTTTTLIEPIRLGGISSTEEMDLKVLQFKNKKLA
ERLEQRQACEDELRERIEKLEKRQATDDATLLIVNRYWAQLDETVEALLRCHESQGELSS
APEAPGTQEGPTCDGTPLPEPGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELE
LQGRMEFSKAAVSRVVEASDRLQRRVEELCQRVYSRGDSEPLSEAAQAHTRELGRENRRL
QDLATQLQEKHHRISLEYSELQDKVTSAETKVLEMETTVEDLQWDIEKLRKREQKLNKHL
AEALEQLNSGYYVSGSSSGFQGGQITLSMQKFEMLNAELEENQELANSRMAELEKLQAEL
QGAVRTNERLKVALRSLPEEVVRETGEYRMLQAQFSLLYNESLQVKTQLDEARGLLLATK
NSHLRHIEHMESDELGLQKKLRTEVIQLEDTLAQVRKEYEMLRIEFEQNLAANEQAGPIN
REMRHLISSLQNHNHQLKGDAQRYKRKLREVQAEIGKLRAQASGSAHSTPNLGHPEDSGV
SAPAPGKEEGGPGPVSTPDNRKEMAPVPGTTTTTTSVKKEELVPSEEDFQGITPGAQGPS
SRGREPEARPKRELREREGPSLGPPPVASALSRADREKAKVEETKRKESELLKGLRAELK
KAQESQKEMKLLLDMYKSAPKEQRDKVQLMAAERKAKAEVDELRSRIRELEERDRRESKK
IADEDALRRIRQAEEQIEHLQRKLGATKQEEEALLSEMDVTGQAFEDMQEQNGRLLQQLR
EKDDANFKLMSERIKANQIHKLLREEKDELGEQVLGLKSQVDAQLLTVQKLEEKERALQG
SLGGVEKELTLRSQALELNKRKAVEAAQLAEDLKVQLEHVQTRLREIQPCLAESRAAREK
ESFNLKRAQEDISRLRRKLEKQRKVEVYADADEILQEEIKEYKARLTCPCCNTRKKDAVL
TKCFHVFCFECVRGRYEARQRKCPKCNAAFGAHDFHRIYIS
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggccaggcaacaaacgcgccgccggcgacgggggctcagggcccccggaaaag
aagctgagtcgtgaggagaagaccaccacgactcttatcgagcccattcgtcttggaggc
atctcttccacggaggagatggacctgaaggtactacagttcaagaacaagaaactggca
gagcggctggaacaacggcaggcttgtgaagatgaactccgagaacgaattgagaagttg
gagaagcggcaggccacagatgatgccacactcctcatcgtcaatcgctactgggcccag
ctggatgaaactgtggaagcccttctccgatgccatgagagccagggggagctgtcttca
gcgcctgaggcacctgggacccaggaggggccaacatgtgatgggactcctctcccagag
ccggggacatcagagctgagagaccccttgctgatgcagctgcggccccctctcagtgag
ccggccttggcttttgtggtggcactgggtgccagcagcagtgaggaggtggagctggag
ctgcaaggccgaatggagttctccaaggcagctgtgtctcgtgtggtagaggcctcagac
cgcctacagcgccgggtggaggaactctgtcagcgagtgtacagccgaggggacagtgag
cccctcagtgaggcggctcaggcacacacccgagagctgggccgtgagaaccggcgactg
caggacttggccactcagctgcaggagaaacaccaccgcatctcattggagtactccgag
ctccaggataaagtgacatcggcagagaccaaggtgctggagatggagacaacagtggag
gacttgcagtgggacatcgagaagctgcggaagcgagagcaaaagctcaataagcacctg
gcagaggccttagagcagcttaactctggctactatgtatctgggagctcctcaggcttc
caggggggccagatcacactcagcatgcagaagtttgagatgctgaatgcagagttagag
gaaaaccaggaactggccaacagccgtatggcagagctggagaaactgcaggccgaactt
cagggggctgtgcggaccaatgagcgcctcaaggtggccctgcggagccttcctgaggag
gtagtgcgggagacgggggagtaccgcatgctgcaggcccaattctcactgctctacaac
gagtctctgcaagtgaagacccagctagacgaggctcggggcctgctgctggccacaaag
aactcccacctgcgacacatcgagcacatggagagcgacgagctggggctgcagaagaag
ctacgcacagaggtcattcagctggaggacacgctggcccaggtacgcaaggagtatgag
atgctgcgcatcgagtttgagcagaatctggcggccaacgagcaggcggggcccatcaac
cgtgagatgcgccacctgattagtagtcttcaaaaccacaaccaccagctaaaaggggac
gcccagcgatacaagcggaagcttcgagaagtacaagctgagattggcaagctccgggcc
caggccagtggctctgcccactccacccccaacctgggccacccagaggattctggcgtc
agtgccccagccccagggaaagaggagggtgggccaggccctgtcagtacccccgacaac
agaaaggagatggctccagtgcctggcaccaccactactaccacttcagtgaagaaggag
gagctggtcccctctgaagaggacttccagggtataacccctggggcccagggcccttcc
tcccggggccgagaacctgaggccaggcccaagcgggagcttcgggaacgggaaggtccc
agcctaggacctccacctgtagcctccgctctctcaagggctgatcgggagaaggccaag
gtggaagaaaccaagcggaaggaatcagaactcctcaagggtctccgagcagagctcaag
aaggcccaggagagccagaaggagatgaaactgctgctggatatgtacaagtcagcgccc
aaggagcagcgggataaggtgcagctcatggcagcggaacgcaaggctaaggccgaggtt
gatgagctgcggagccgcatccgggaattggaggagagggatcgaagggagagcaagaag
atcgcggatgaggatgccctgcggcgcattcggcaggcagaggagcagatagaacacctg
cagcgcaagctgggtgccaccaagcaggaggaggaggctctgctctcagagatggatgtg
acaggtcaggcttttgaggacatgcaggaacagaacgggcggctgctacagcagttgcgg
gaaaaggatgatgccaactttaagctaatgtcagagcggatcaaggccaaccagattcac
aagctgctgcgggaggagaaggatgagttgggcgagcaggtccttggcctcaagtcccag
gtggatgcccagctgctgactgtgcagaagctggaggagaaggagcgagccttgcagggc
agcctcgggggtgtggagaaggagctgacgctgcgcagccaagccctggagctcaacaag
cggaaggctgtagaagccgcccagctggccgaggacctgaaggtgcagctggagcacgtg
cagactcggctgcgggagatccagccctgcctggcagagagccgggctgctcgtgagaaa
gagagcttcaacctcaagagggctcaggaggacatctcacggctgcggcgcaagctggaa
aagcagaggaaggtggaggtctacgcagatgccgacgaaatcctccaggaggagatcaag
gagtacaaggcgcggttgacctgcccctgctgtaacacccgcaagaaggatgcagtcctt
accaagtgcttccacgttttctgcttcgagtgcgtgcggggccgctatgaggcccgccag
aggaagtgccccaagtgcaacgcggcctttggtgcccacgacttccatcgtatctacatc
agctga

DBGET integrated database retrieval system